Recombinant Escherichia coli UPF0225 protein ychJ(ychJ)

Product Type Recombinant Protein
Uniprot No. B1ITM1
Species Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Gene Names ychJ
Protein Names Recommended name: UPF0225 protein ychJ
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Product Details for Different Expression Systems

Product Name Recombinant Escherichia coli UPF0225 protein ychJ(ychJ),Yeast
Code CSB-YP535561ENP
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMQDADYLIKTWHPSCGAA ALRAELIAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENG QWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ
Expression Region 1-152
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Escherichia coli UPF0225 protein ychJ(ychJ),E.coli
Code CSB-EP535561ENP
Size Pls inquiry other sizes
Source E.coli
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-SUMO-tagged and C-terminal Myc-tagged
N-terminal His-B2M-tagged and C-terminal Myc-tagged
N-terminal His-GST-tagged and C-terminal Myc-tagged
N-terminal His-tagged
N-terminal His-SUMO-tagged
N-terminal His-B2M-tagged
N-terminal His-GST-tagged
N-terminal GST-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMQDADYLIKTWHPSCGAA ALRAELIAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENG QWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ
Expression Region 1-152
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Escherichia coli UPF0225 protein ychJ(ychJ),Baculovirus
Code CSB-BP535561ENP
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMQDADYLIKTWHPSCGAA ALRAELIAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENG QWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ
Expression Region 1-152
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Escherichia coli UPF0225 protein ychJ(ychJ),Mammalian cell
Code CSB-MP535561ENP
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MSQLCPCGSAVEYSLCCHPYVSGEKVAPDPEHLMRSRYCAFVMQDADYLIKTWHPSCGAA ALRAELIAGFAHTEWLGLTVFEHCWQDADNIGFVSFVARFTEGGKTGAIIERSRFLKENG QWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ
Expression Region 1-152
Protein Description full length protein
Storage Buffer PBS pH 7.4, 50% glycerol
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

ychJ Antibodies

ychJ Antibodies for Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.