Product Details

Purity

Greater than 85% as determined by SDS-PAGE

Activity

Not Test

Uniprot No.

Q46865

Research Area

Others

Species

Escherichia coli (strain K12)

Expression Region

1-98aa

Target Protein Sequence

MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.1 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant E. coli mRNA interferase MqsR (mqsR) is a compact RNase-toxin protein produced for research use. MqsR is a well-known component in bacterial stress-response studies because it is associated with rapid mRNA turnover and growth regulation within toxin–antitoxin modules.

MqsR (YgiU) is the toxin component of the MqsR/MqsA type II toxin–antitoxin (TA) system. It is characterized as an mRNA interferase that can cleave single-stranded RNA with reported preference around GCU-containing sites, leading to suppression of translation. Beyond its enzymatic description, MqsR is frequently discussed in pathways related to stress adaptation, biofilm-associated regulation, and persistence.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

* Antibody generation & assay development: use as an immunogen to support antibody production or to optimize immunoassays that recognize MqsR in bacterial lysates.

* Binding and interaction studies (activity-independent): suitable for validating protein–protein binding concepts in TA systems (e.g., toxin–antitoxin association) using pull-down, ELISA-based binding, or other affinity assays.

* Structural/biophysical characterization: applicable for SDS-PAGE/Western controls, tag-based purification tests, or exploratory structural studies where enzymatic activity is not required.

* Functional RNase assays (optional): if you plan RNA cleavage experiments, a small-scale pilot test is recommended since the activity of this product is not tested, and reaction conditions may need optimization.

Target Background

Function

Toxic component of a type II toxin-antitoxin (TA) system. Plays a significant role in the control of biofilm formation and induction of persister cells in the presence of antibiotics. An mRNA interferase which has been reported to be translation-independent. It has also been reported to be translation-dependent. Cleavage has been reported to occur on either side of G in the sequence GCU. Also reported to cleave after C in GC(A/U) sequences. There are only 14 genes in E.coli W3110 (and probably also MG1655) that do not have a GCU sequence and thus are resistant to the mRNA interferase activity; among these is the gene for toxin GhoT. Overexpression of MqsR causes cessation of cell growth and inhibits cell proliferation via inhibition of translation as well as increasing persister cell formation; these effects are overcome by concomitant or subsequent expression of antitoxin MqsA. Cross-talk can occur between different TA systems. Ectopic expression of this toxin induces transcription of the relBEF TA system operon with specific cleavage of the relBEF mRNA produced. Regulates the expression of GhoT/GhoS, a type V TA system. Persistence depends on toxin GhoT activity, which MqsR controls at the post-transcriptional level by selectively degrading the antitoxin ghoS segment of the ghoST mRNA. Overexpression leads to a dramatic increase in tolerance to the antibiotic ofloxacin. This TA system mediates cell growth during bile acid deoxycholate stress by degrading mRNA for probable deoxycholate-binding protein YgiS; bile acid detergents such as deoxycholate are important for host defense against bacterial growth in the gall bladder and duodenum.; Initially reported to act as a cotranscription factor with MqsA. Following further experiments, the MqsR-MqsA complex does not bind DNA and all reported data are actually due to a small fraction of free MqsA alone binding DNA. Addition of MqsR to a preformed MqsA-promoter DNA complex causes dissociation of the MqsA-DNA complex, probably causing derepression of MqsA-repressed transcripts. Does not bind DNA in the presence or absence of MqsA.

Gene References into Functions

Therefore, the more toxic MqsR increases persistence by decreasing the ability of the cell to respond to antibiotic stress through its RpoS-based regulation of acid resistance, multidrug resistance and osmotic resistance systems. PMID: 22221537
MqsA protein was cocrystallized with a 26-mer duplex DNA corresponding to the palindromic region of the mqsRA promoter PMID: 20823526
The mqsR gene encodes a toxin, and ectopic expression of this gene inhibits growth and induces rapid shutdown of protein synthesis in vivo. PMID: 20233923
MqsR influences persister formation since deletion of mqsRA reduces persister cell formation and MqsR overexpression increases persister cell formation. PMID: 19909729
Here, we report multiple individual and complex three-dimensional structures of MqsR and its antitoxin MqsA (B3021), which reveal that MqsR:MqsA form a novel toxin:antitoxin (TA) pair. PMID: 20041169
results indicate AI-2 induces biofilm formation in E. coli through B3022, which then regulates QseBC and motility; hence, b3022 has been renamed the motility quorum-sensing regulator gene (mqsR gene) PMID: 16352847
MqsR, a crucial regulator for quorum sensing and biofilm formation, is a GCU-specific mRNA interferase in Escherichia coli PMID: 19690171

Hide All

Database Links

KEGG: ecj:JW2990

STRING: 316385.ECDH10B_3196

Code	CSB-EP674977ENV
Abbreviation	Recombinant E.coli mqsR protein
MSDS	MSDS Datasheet
Size
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli mRNA interferase MqsR(mqsR)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage