Home
Protein
Recombinant Protein
Recombinant Cat Serum amyloid A protein (SAA1), partial

Recombinant Cat Serum amyloid A protein (SAA1), partial

^{In Stock}

Code	CSB-EP020656CA
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SAA1

Uniprot No.

P19707

Alternative Names

SAA1Serum amyloid A protein; SAA) [Cleaved into: Amyloid protein A; Amyloid fibril protein AA)]

Species

Felis catus (Cat) (Felis silvestris catus)

Source

E.coli

Expression Region

1-90aa

Target Protein Sequence

EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

24.1 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-B2M-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of the recombinant Felis catus SAA1 protein begins with the creation of the recombinant plasmid, which is synthesized by inserting the gene encoding the Felis catus SAA1 protein (1-90aa) into a plasmid vector. The recombinant plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected and then cultured under conditions conducive to the expression of the gene of interest. The protein is equipped with a N-terminal 6xHis-B2M tag. Following expression, the recombinant SAA1 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Felis catus SAA1 protein, demonstrating a purity exceeding 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

The sequence corresponds to beginning of the mature chain - 96% homology with aa19-111 rather than aa1-90 as stated on datasheet. Please can you confirm the sequence is correct.

Thanks for your inquiry. Regarding your questions of CSB-EP020656CA, I checked with our technical team and was informed that what we provide is the region aa1-90 (Last modified October 16, 2013. Version 53.) , which is indeed 96% homology with aa 19-111.

Target Background

Function

Major acute phase reactant. Apolipoprotein of the HDL complex.

Involvement in disease

Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular Location

Secreted.

Protein Families

SAA family

Tissue Specificity

Expressed by the liver; secreted in plasma.

Database Links

STRING: 9685.ENSFCAP00000020110

Promotions