Recombinant Cat Serum amyloid A protein(SAA1),partial

In Stock
Code CSB-EP020656CA
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P19707
Lead Time 3-7 business days
Relevance Major acute phase reactant. Apolipoprotein of the HDL complex.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Amyloid fibril protein AACurated
Species Felis catus (Cat) (Felis silvestris catus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Source E.coli
Gene Names SAA1
Protein Names Amyloid fibril protein AACurated
Expression Region 1-90aa
Tag Info N-terminal 6xHis-B2M-tagged
Mol. Weight 24.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Subcellular Location Secreted
Protein Families SAA family
Tissue Specificity Expressed by the liver; secreted in plasma.
Database Links

STRING: 9685.ENSFCAP00000020110

Q&A and Customer Reviews

Q&A
Q:

The sequence corresponds to beginning of the mature chain - 96% homology with aa19-111 rather than aa1-90 as stated on datasheet. Please can you confirm the sequence is correct.

A:
Thanks for your inquiry. Regarding your questions of CSB-EP020656CA, I checked with our technical team and was informed that what we provide is the region aa1-90 (Last modified October 16, 2013. Version 53.) , which is indeed 96% homology with aa 19-111.
Customer Reviews

Related Products

SAA1 Antibodies

SAA1 Antibodies for Felis catus (Cat) (Felis silvestris catus)

SAA1 Proteins

SAA1 Proteins for Felis catus (Cat) (Felis silvestris catus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.