Recombinant Helicobacter pylori DNA protection during starvation protein (dps)

In Stock
Code CSB-EP337381HUV
Abbreviation Recombinant Helicobacter pylori dps protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP337381HUV could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP337381HUV could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
dps
Uniprot No.
Research Area
Microbiology
Alternative Names
dps; napA; HP_0243DNA protection during starvation protein; EC 1.16.-.-; Bacterioferritin; HP-NAP; Neutrophil-activating protein A; NAP A
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Source
E.coli
Expression Region
1-144aa
Target Protein Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Helicobacter pylori DNA protection during starvation protein (dps) is produced in E.coli and contains the complete protein sequence from amino acids 1 to 144. The protein comes with an N-terminal 6xHis-SUMO tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms the product reaches a purity level greater than 90%, which appears suitable for research applications.

The DNA protection during starvation protein (dps) in Helicobacter pylori seems to play a critical role in protecting DNA under oxidative stress and during periods of nutrient deprivation. It's involved in forming a compact nucleoid that may shield DNA from damage. This has made it a significant focus of research in bacterial survival mechanisms and stress responses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Helicobacter pylori Dps is a bacterial nucleoid-associated protein that forms dodecameric complexes and requires iron binding for its DNA protection function. The E. coli expression system is generally compatible with bacterial proteins, and the SUMO tag may enhance solubility. However, Dps requires precise oligomerization (12-mer formation) for activity, and the large N-terminal SUMO tag (∼15 kDa) may sterically interfere with proper dodecamer assembly. While the protein may be soluble, the probability of correct oligomerization and functional activity is moderate but requires experimental validation due to potential tag interference.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The large SUMO tag may sterically hinder interaction interfaces or prevent proper dodecamer formation, leading to non-specific binding or failure to identify genuine partners. If correctly oligomerized, it could reveal physiological interactions, but results require validation with tag-free protein.

2. Antibody Development and Validation

This recombinant Dps serves as an excellent immunogen for generating antibodies against H. pylori Dps. The full-length sequence ensures comprehensive coverage of the epitope. The high purity minimizes antibodies against contaminants. These antibodies will be valuable for detecting Dps in bacterial samples.

3. Biochemical Characterization and Protein Stability Studies

This is the essential first step to assess protein quality. Techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can determine oligomeric state and confirm dodecamer formation. Circular dichroism can analyze secondary structure, and iron-binding assays can validate functional activity. SUMO protease cleavage allows comparison of tagged vs. untagged protein properties.

4. Comparative Proteomics and Cross-Species Analysis

This protein can be used for sequence-based comparisons and immunological studies. However, functional comparative analyses (e.g., DNA-binding affinity, oxidative stress protection) require proper oligomerization and would be invalid if the tag interferes with dodecamer formation.

Final Recommendation & Action Plan

This recombinant Dps has potential for multiple applications but requires validation of oligomerization and functional activity before reliable use in interaction or comparative functional studies. The immediate priority is Application 3 (Biochemical Characterization) to assess dodecamer formation via SEC-MALS and validate iron-binding/DNA-protection activity. If proper oligomerization is confirmed, proceed with Applications 1 and functional aspects of Application 4. Application 2 (Antibody Development) can proceed immediately. Consider SUMO tag removal for critical functional studies. This systematic approach ensures appropriate use based on functional validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction. Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.
Gene References into Functions
  1. H. pylori NapA has unique and separate roles in gastric pathogenesis. PMID: 17030577
Subcellular Location
Cytoplasm.
Protein Families
Dps family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*