Recombinant Helicobacter pylori DNA protection during starvation protein (dps)

In Stock
Code CSB-EP337381HUV
Abbreviation Recombinant Helicobacter pylori dps protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP337381HUV could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP337381HUV could indicate that this peptide derived from E.coli-expressed Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) dps.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
dps
Uniprot No.
Research Area
Microbiology
Alternative Names
dps; napA; HP_0243DNA protection during starvation protein; EC 1.16.-.-; Bacterioferritin; HP-NAP; Neutrophil-activating protein A; NAP A
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Source
E.coli
Expression Region
1-144aa
Target Protein Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Helicobacter pylori DNA protection during starvation protein (dps) is produced in E.coli and contains the complete protein sequence from amino acids 1 to 144. The protein comes with an N-terminal 6xHis-SUMO tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms the product reaches a purity level greater than 90%, which appears suitable for research applications.

The DNA protection during starvation protein (dps) in Helicobacter pylori seems to play a critical role in protecting DNA under oxidative stress and during periods of nutrient deprivation. It's involved in forming a compact nucleoid that may shield DNA from damage. This has made it a significant focus of research in bacterial survival mechanisms and stress responses.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag allows for nickel affinity-based pull-down experiments to identify potential binding partners of H. pylori Dps protein. Researchers can immobilize the recombinant protein on nickel-coated beads and incubate it with bacterial lysates or purified proteins to capture interacting molecules. The >90% purity should minimize background binding from contaminants. This approach might reveal novel regulatory networks involving Dps in H. pylori stress response pathways.

2. Antibody Development and Validation

The high purity recombinant Dps protein could serve as an excellent immunogen for generating polyclonal or monoclonal antibodies specific to H. pylori Dps. Since the full-length protein (1-144aa) contains all native epitopes, it should provide comprehensive antibody recognition. Researchers can validate generated antibodies using Western blot, immunoprecipitation, or ELISA formats with the same recombinant protein as a positive control. These antibodies would likely prove valuable for studying Dps expression and localization in H. pylori research.

3. Biochemical Characterization and Protein Stability Studies

The purified recombinant protein makes detailed biochemical analysis possible, including thermal stability, pH tolerance, and oligomerization studies. Techniques such as dynamic light scattering, differential scanning calorimetry, and analytical ultracentrifugation can be applied. SUMO protease treatment can remove the SUMO tag to study the native protein properties. These studies would provide fundamental insights into Dps protein behavior under various environmental conditions relevant to H. pylori survival strategies.

4. Comparative Proteomics and Cross-Species Analysis

The recombinant H. pylori Dps protein can serve as a reference standard in comparative studies with Dps homologs from other bacterial species. The high purity allows for accurate quantitative comparisons using mass spectrometry-based approaches. The His-tagged protein makes consistent purification protocols possible for parallel studies. Such comparative analyses might reveal species-specific adaptations and evolutionary relationships within the Dps protein family.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction. Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.
Gene References into Functions
  1. H. pylori NapA has unique and separate roles in gastric pathogenesis. PMID: 17030577
Subcellular Location
Cytoplasm.
Protein Families
Dps family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*