Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
vacA; HP_0887; Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator]
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Expression Region
37-245aa
Target Protein Sequence
TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This protein is a recombinant H.pylori vacA protein with N-terminal 6xHis tag. Its purity is 90% determined by SDS-PAGE. The production includes 5 steps. 1, obtain the cDNA from the respective mRNA; 2, Select expression vector to insert the vacA sequence and get the recombinant plasmid of vacA; 3, Clone the recombinant plasmid into E.coli; 4, Express the vacA protein in the E.coli cell; 5, Protein purification. And finally, the desired recombinant protein was obtained. In addition, the activity has been tested.
vacA is a gene encoding a protein called vacuolating cytotoxin autotransporter (also known as vacuolating cytotoxin). vacA protein contains a signal peptide that mainly guides the autotransporter protein to the periplasmic space and is cleaved at the inner membrane. In Helicobacter pylori, vacA is a critical virulence factor, is considered a multifunctional toxin, responsible for eliciting several different effects on host cells, including vacuolization, necrosis, and apoptosis. Increasing evidence indicates that the Helicobacter pylori VacA can promote progressive vacuolation and gastric injury and may be associated with human gastric cancer.
-SDS.jpg)
-1.jpg)
-2.jpg)
