Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter (vacA), partial

In Stock
Code CSB-EP345927HUV1
Abbreviation Recombinant Helicobacter pylori vacA protein, partial
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
vacA
Uniprot No.
Research Area
Others
Alternative Names
vacA; HP_0887; Vacuolating cytotoxin autotransporter [Cleaved into: Vacuolating cytotoxin; Vacuolating cytotoxin translocator]
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Source
E.coli
Expression Region
37-245aa
Target Protein Sequence
TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This protein is a recombinant H.pylori vacA protein with N-terminal 6xHis tag. Its purity is 90% determined by SDS-PAGE. The production includes 5 steps. 1, obtain the cDNA from the respective mRNA; 2, Select expression vector to insert the vacA sequence and get the recombinant plasmid of vacA; 3, Clone the recombinant plasmid into E.coli; 4, Express the vacA protein in the E.coli cell; 5, Protein purification. And finally, the desired recombinant protein was obtained. In addition, the activity has been tested.

vacA is a gene encoding a protein called vacuolating cytotoxin autotransporter (also known as vacuolating cytotoxin). vacA protein contains a signal peptide that mainly guides the autotransporter protein to the periplasmic space and is cleaved at the inner membrane. In Helicobacter pylori, vacA is a critical virulence factor, is considered a multifunctional toxin, responsible for eliciting several different effects on host cells, including vacuolization, necrosis, and apoptosis. Increasing evidence indicates that the Helicobacter pylori VacA can promote progressive vacuolation and gastric injury and may be associated with human gastric cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces vacuolation of eukaryotic cells. Causes ulceration and gastric lesions.
Gene References into Functions
  1. Helicobacter pylori VacA induces autophagic cell death in gastric epithelial cells via the endoplasmic reticulum stress pathway. PMID: 29238039
  2. The results indicate that cortactin is involved in the regulation of apoptosis induced by VacA in gastric cells. PMID: 26289258
  3. Genotype testing of vacA s- and m- region will be useful in screening susceptible individuals for duodenal ulcer development. PMID: 25063579
  4. These results suggested that cagA and vacA gene expression is upregulated in Helicobacter pylori, especially by host cell contact, and Fur has a role in the upregulation. PMID: 24020886
Subcellular Location
[Vacuolating cytotoxin autotransporter]: Periplasm.; [Vacuolating cytotoxin]: Secreted. Cell surface.; [Vacuolating cytotoxin translocator]: Cell outer membrane; Multi-pass membrane protein.
Database Links

KEGG: hpy:HP0887

STRING: 85962.HP0887

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*