Recombinant Human Mediator of DNA damage checkpoint protein 1 (MDC1), partial

Code CSB-EP623929HU
Abbreviation Recombinant Human MDC1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
MDC1
Uniprot No.
Alternative Names
Homologue to Drosophila photoreceptor protein calphotin; MDC 1; Mdc1; MDC1_HUMAN; Mediation of DNA damage checkpoint 1; Mediator of DNA damage checkpoint 1; Mediator of DNA damage checkpoint protein 1; NFBD 1; NFBD1; Nuclear factor with BRCT domains 1; Nuclear Factor with BRCT Domains Protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1892-2082aa
Target Protein Sequence
APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. May serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked by 'Ser-139' phosphorylation of histone H2AX. Also required for downstream events subsequent to the recruitment of these proteins. These include phosphorylation and activation of the ATM, CHEK1 and CHEK2 kinases, and stabilization of TP53 and apoptosis. ATM and CHEK2 may also be activated independently by a parallel pathway mediated by TP53BP1.
Gene References into Functions
  1. Our data highlight that NFBD1 participates in the regulation of proliferation and apoptosis in laryngeal squamous cell carcinoma PMID: 28921460
  2. These findings indicate that the c-Fos/miR-22/MDC1 axis plays a relevant role in DNA repair in terminally differentiated cells, which may facilitate our understanding of molecular mechanism underlying the downregulating DNA repair in differentiated cells. PMID: 28637007
  3. key component of the DNA damage response and interacts with several factors such as gamma-H2AX PMID: 29026069
  4. prognostic marker in predicting relapse-free survival in oral squamous cell carcinoma PMID: 28161894
  5. It showed a link between the status of MDC1 protein and TP53 gene, which specific mutations caused radiation-induced MDC1 down-regulation. PMID: 28397142
  6. ASF1a promotes non-homologous end joining repair by facilitating phosphorylation of MDC1 by ATM at double-strand breaks. PMID: 28943310
  7. the opposing activities of RNF4 and ataxin-3 consolidate robust MDC1-dependent signaling and repair ofDNA double-strand break. PMID: 28275011
  8. NFBD1 protein is overexpressed in NPC tissues and that silencing NFBD1 can inhibit cell growth, induce apoptosis, increase the production of intracellular ROS. NFBD1 knockdown also inhibits the tumorigenicity of NPC cells in vivo. PMID: 28081741
  9. NFBD1 knockdown improves the chemosensitivity of NPC cells by inhibiting cell growth and promoting apoptosis through the impairment of DNA damage repair, suggesting NFBD1 as a novel therapeutic target for NPC. PMID: 27334757
  10. knockdown of MCM2 or MCM6 could significantly inhibit foci forming of MDC1 in TE-1 nuclei in response to bleomycin-induced DNA damage (p < 0.001). This study indicates the direct interaction between MDC1 and MCMs in TE-1 nuclei. PMID: 27908247
  11. MDC1 recruits TNKS1 and TNKS2 to DNA lesions. PMID: 26845027
  12. MDC1 silencing enhances the radiosensitivity of human nasopharyngeal cancer CNE1 cells and results in xenograft tumor growth inhibition. PMID: 26247734
  13. we generated two HEP-2 cell lines with a stable knockdown of MDC1 or 53BP1 with short hairpin RNA (shRNA), respectively, and investigated the effect of MDC1 and 53BP1 on cell radiosensitivity PMID: 25976740
  14. During replicative senescence and stress-induced premature senescence, MDC1 is downregulated by upregulating miR-22. PMID: 25627978
  15. we have identified a novel antisense lncRNA MDC1-AS, which may participate in bladder cancer through up-regulation of its antisense tumor-suppressing gene MDC1 PMID: 25514464
  16. our findings suggest that MDC1 promotes ovarian cancer metastasis through the induction of EMT. PMID: 25592380
  17. The study suggest that MDC1 as an epigenetic modifier regulates androgen receptor transcriptional activity and MDC1 may function as a tumor suppressor of prostate cancer. PMID: 25934801
  18. data suggested that the SNP rs4713354A>C of MDC1 may be a functional genetic biomarker for susceptibility to lung cancer in Chinese PMID: 25198518
  19. NFBD1/MDC1 is phosphorylated by PLK1 and controls G2/M transition through the regulation of a TOPOIIalpha-mediated decatenation checkpoint. PMID: 24349352
  20. ATM and MDC1 maintain genomic stability not only by controlling the DNA damage response, but also by regulating spindle assembly checkpoint activation, providing an important link between these two essential biological processes. PMID: 24509855
  21. The TOPBP1 phosphate-binding pocket and positively charged residues in a variant loop in BRCT5 present an extended binding surface for the negatively charged MDC1 phosphopeptide. PMID: 23891287
  22. Silencing MDC1 can enhance the radiosensitivity of esophageal squamous cell carcinoma ECA109 cells in vitro. PMID: 20813677
  23. PARP1 activation and BAL1-BBAP recruitment to DNA damage sites are independent of ATM and MDC1. PMID: 23230272
  24. proteins accumulate into foci with characteristic mean recruitment times tau(1). Mdc1 accumulates faster than 53BP1 after high LET irradiation PMID: 22860035
  25. inhibition in the activity of the core mitotic regulator CDK1 enhances MDC1-gammaH2AX colocalization in mitosis. PMID: 22962268
  26. A dual interaction between the DNA damage response protein MDC1 and the RAG1 subunit of the V(D)J recombinase. PMID: 22942284
  27. distinct dynamics of MDC1 and 53BP1 at different types of nuclear structures PMID: 22677490
  28. It was shown that MDC1 is sumoylated after DNA damage, and sumoylation of MDC1 at Lys1840 is needed for MDC1 degradation and removal of MDC1 and 53BP1 from DNA damage sites. Sumoylated MDC1 was ubiquitinated by the SUMO-targeted E3 ubiquitin ligase RNF4. PMID: 22635276
  29. A major binding target of the Mdc1 FHA domain is a previously unidentified DNA damage and ATM-dependent phosphorylation site near the N-terminus of Mdc1 itself. PMID: 22234878
  30. expression of NFBD1 seems to be related to the oncogenic potential of cervical cancer, and suppression of its expression can inhibit cancer cell growth both in vitro and in vivo PMID: 21853275
  31. As compared to the MDC1 forkhead-associated FHA) domain, the MU2 FHA domain dimerizes using a different and more stable interface and contains a degenerate phosphothreonine-binding pocket. PMID: 22273583
  32. MDC1 is required for the recruitment of RAP80 to DNA double-strand breaks. PMID: 21857162
  33. structural insight into MDC1-CHK2 interaction PMID: 22211259
  34. This study provides the first evidence that interactions involving MDC1 can be regulated by ubiquitylation PMID: 21622030
  35. most NFBD1 regulated genes are regulated in both the absence and presence of IR, thus pointing toward a novel function for NFBD1 outside of the DNA damage response PMID: 21551225
  36. this study reveals that human NIPBL is a novel protein recruited to DSB sites, and the recruitment is controlled by MDC1, RNF168 and HP1gamma. PMID: 21784059
  37. The specific TopBP1-MDC1 interaction was mediated by the fifth BRCT domain of TopBP1 and the Ser-Asp-Thr repeats of MDC1. TopBP1 accumulation at stalled replication forks was promoted by the H2AX/MDC1 signaling cascade. PMID: 21482717
  38. Mediator of DNA damage checkpoint protein 1 (MDC1) has a role in nodal recurrence in early-stage breast cancer patients treated with breast-conserving surgery and radiation therapy PMID: 20521098
  39. Results implicate MDC1 in the cellular apoptotic response. PMID: 21148072
  40. High NFBD1 is associated with esophageal cancer. PMID: 20364298
  41. The viral oncoprotein tax sequesters DNA damage response factors by tethering MDC1 to chromatin. PMID: 20729195
  42. NFBD1 has a pivotal role in the regulation of proper mitotic entry. PMID: 20529673
  43. MDC1 and 53BP1 expressions were observed for the first time in human esophageal carcinoma cell lines TE-1,TE-13 and Eca109 cells, at both the mRNA and protein levels. PMID: 17884766
  44. structure & peptide binding specificity of BRCT domains of MDC1 & BRCA1; crystal structures of BRCA1 & MDC1 bound to peptides show differences in the environment of conserved arginines that determine affinity for peptides with -COO(-) vs -CO-NH(2) termini PMID: 20159462
  45. This nuclear protein with signature motifs of FHA and BRCT, and an internal 41-amino acid repeat sequence, is an early participant in DNA damage response. PMID: 12475977
  46. role in DNA damage signaling pathways PMID: 12499369
  47. NFBD1 is parallel to 53BP1 in regulating Chk2 and downstream of H2AX in the recruitment of repair and signaling proteins to sites of DNA damage in tumor cells PMID: 12551934
  48. MDC1-mediated focus formation by the MRE11 complex at sites of DNA damage is crucial for the efficient activation of the intra-S-phase checkpoint PMID: 12607003
  49. MDC1 is recruited through its FHA domain to the activated CHK2 and has a critical role in CHK2-mediated DNA damage responses PMID: 12607004
  50. role for MDC1 in mediating transduction of the DNA damage signal PMID: 12607005

Show More

Hide All

Subcellular Location
Nucleus. Chromosome. Note=Associated with chromatin. Relocalizes to discrete nuclear foci following DNA damage, this requires 'Ser-139' phosphorylation of H2AX. Colocalizes with APTX at sites of DNA double-strand breaks.
Tissue Specificity
Highly expressed in testis.
Database Links

HGNC: 21163

OMIM: 607593

KEGG: hsa:9656

STRING: 9606.ENSP00000365588

UniGene: Hs.653495

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*