Recombinant Human 14-3-3 protein theta(YWHAQ)

Code CSB-EP026290HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names YWHAQ
Uniprot No. P27348
Research Area Neuroscience
Alternative Names 14-3-3 protein T cell; 14-3-3 protein T-cell; 14-3-3 protein tau; 14-3-3 protein theta; 1433T_HUMAN; IC5; Protein HS1; Protein tau; YWHAQ tyrosine 3 monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; Ywhaq
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-245aa
Target Protein Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 54.8kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Gene References into Functions
  1. Chk1 and 14-3-3 proteins cooperate to inactivate the transcriptional repressor functions of atypical E2F proteins. This mechanism might be of particular importance to cancer cells, since they are exposed frequently to DNA-damaging therapeutic reagents. PMID: 29363506
  2. results suggest that PKC SUMOylation is an important regulator of the 14-3-3 and GluK2a protein complex and may contribute to regulate the decay kinetics of kainate receptor-excitatory postsynaptic currents PMID: 28837400
  3. Results show that 14-3-3zeta promotes cell proliferation, migration and invasion in lung adenocarcinoma. 14-3-3zeta upregulates MUC1 expression through enhancing MUC1/NFkappaB feedback loop. Its high expression is associated with poor survival in lung adenocarcinoma patients. PMID: 28901525
  4. TGFbetaR1 signaling was involved in 14-3-3zeta-mediated cell proliferation and metastasis of lung squamous cell carcinoma cells. PMID: 27764818
  5. Loss of Par3 promotes metastatic behavior in lung adenocarcinoma cells through 14-3-3zeta protein. PMID: 27588399
  6. this study reveals that 14-3-3zeta plays a critical role in Wnt5a/ROR1 signaling, leading to enhanced CLL migration and proliferation. PMID: 28465528
  7. Our results indicate that TRIM25 is associated with cisplatin resistance and 14-3-3sigma-MDM2-p53 signaling pathway is involved in this process, suggesting targeting TRIM25 may be a potential strategy for the reversal of cisplatin resistance. PMID: 28867193
  8. Up-regulation of 14-3-3zeta in response to pVHL is important for the recruitment of PI3K to the cell membrane and for stabilization of soluble beta-catenin. PMID: 28666999
  9. The 14-3-3 family is dysregulated in schizophrenia, perhaps owing to specific regulatory mechanisms; the expression of the 14-3-3 epsilon, theta and zeta isoforms could be useful indicators of disease severity. PMID: 27030512
  10. High urine 14-3-3 expression is associated with Advanced Stage in Patients with Clear Cell Renal Cell Carcinoma. PMID: 27039779
  11. Levels of 14-3-3 protein predict poorer radiographic outcomes in inflammatory polyarthritis patients. PMID: 26832367
  12. Study shows that 14-3-3 zeta/delta is important in the extracellular vesicles mediated induction of colon malignant phenotype, suggesting its role as a potential target for therapeutic interventions. PMID: 26231887
  13. the effects of cell viability, migration and invasion were mediated in 14-3-3zeta-dependent manner while that of cell apoptosis was mediated in 14-3-3zeta-independent manner. PMID: 26054824
  14. 14-3-3zeta reduces DNA damage by interacting with and stabilizing proliferating cell nuclear antigen PMID: 25169136
  15. phosphorylation of HS1 tyrosines at positions 222, 378 and 397 was required for transendothelial migration of NK cells. PMID: 25723543
  16. Mimitin and 14-3-3 protein zeta/delta are potential markers of paclitaxel resistance and prognostic factors in ovarian cancer. PMID: 26033570
  17. 14-3-3S is an interesting protein biomarker with the potential to further improve the accuracy of differential diagnostic process of hepatocellular tumors. PMID: 25448011
  18. The observed participation of 14-3-3 tau in the regulation of the placental epigenome may participate in the molecular mechanisms that govern the pathological process of preeclampsia, although this requires further evaluation. PMID: 25305692
  19. Epigenetic silencing of 14-3-3sigma occurred more frequently in the chronic inflammation group than in cancer patients and healthy controls. PMID: 25041782
  20. 14-3-3epsilon is involved in the regulation of cell cycle control, apoptosis, adhesion, carbohydrate metabolism, and nucleic acid metabolism. PMID: 24363202
  21. CCL20 and 14-3-3 zeta are molecules that play a putative role during tumorgenesis in pancreas, and may therefore be new parameters for histological diagnosis and discrimination between pancreatic neoplasms and chronic pancreatitis. PMID: 24629487
  22. Significant down-regulation of brain 14-3-3 levels were identified during prion infection. PMID: 24135906
  23. In this minireview, we focus on mechanisms of the 14-3-3 protein-dependent regulation of three important 14-3-3 binding partners: yeast neutral trehalase Nth1, regulator of G-protein signaling 3 (RGS3), and phosducin. [review] PMID: 24564655
  24. Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner. PMID: 24038028
  25. 14-3-3s not only can bind and regulate the activity of multiple phosphoproteins, but also possess moonlighting chaperone-like activity PMID: 24681339
  26. Data indicate that 14-3-3 zeta, gamma, epsilon, and tau isoforms but not the sigma protein hydrolyze ATP. PMID: 24269678
  27. Non-sigma 14-3-3 proteins synergized with ETV1 to activate transcription. PMID: 23774214
  28. 14-3-3 negatively regulates the RGC downstream of the PI3-kinase/Akt signaling pathway PMID: 23386617
  29. Data demonstrated that 14-3-3tau enhances the transcriptional activity of PR-B. PMID: 22967481
  30. this mini-review attempts to collect and to describe the data concerning monomers of 14-3-3.[review] PMID: 23159940
  31. a weak complex between RhoGAP protein ARHGAP22 and signal regulatory protein 14-3-3 has 1:2 stoichiometry and a single peptide binding mode PMID: 22952583
  32. An isoform-specific role for 14-3-3 protein is associated with atherosclerotic lesions of the cerebral and carotid arteries. PMID: 22405925
  33. Cerebrospinal fluid protein 14-3-3 detection remains an important test in the diagnosis of Creutzfeldt-Jakob disease. PMID: 23012332
  34. egradation of antiapoptosis protein 143-3beta induced by PrP106-126 peptide may be one of pathogenesis mechanism of prion disease PMID: 22978167
  35. LRFN4 complexed with 14-3-3s and NCK1 to mediate elongation in monocytic cells via Rac-1-mediated actin cytoskeleton reorganization PMID: 22677168
  36. 14-3-3 interacts with nonphosphorylated tau and promotes its interaction with and phosphorylation by a number of protein kinases. PMID: 21876254
  37. It was shown that ARF6 competes with 14-3-3 for binding to centralspindlin such that midbodies formed by centralspindlin mutants that can bind 14-3-3 but not ARF6 frequently collapse before abscission. PMID: 22580824
  38. autophosphorylation of Thr336 acts as an activating signal for LKB1 to recruit 14-3-3, which in turn attenuates the activation of LKB1 to keep the activity of LKB1 in check. PMID: 22575644
  39. 14-3-3 theta/tau and tBID have roles as predictive biomarkers of neoadjuvant chemotherapy resistance in breast cancer PMID: 22115752
  40. Altered 14-3-3 expression in brain can contribute to synaptic dysfunction and altered neurotransmission in chronic alcohol misuse by human subjects. PMID: 21332526
  41. Results suggest that the 14-3-3 protein binding affects the structure of the Galpha interaction portion of RGS3 as well as sterically blocks the interaction between the RGS domain and the Galpha subunit of heterotrimeric G proteins. PMID: 22027839
  42. 14-3-3 proteins mediate CaR-dependent Rho signalling and may modulate the plasma membrane expression of the CaR. PMID: 22010828
  43. 14-3-3beta has oncogenic potential in breast cancer via binding to ERalpha and activation of the transcriptional activity of ERalpha. PMID: 21946067
  44. 14-3-3 theta is a new and important regulatory protein in the TLR-2 and TLR-4 signaling suppressing the MyD88-dependent pathway PMID: 21827211
  45. The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein). PMID: 21728994
  46. Results suggest that 14-3-3 proteins may be associated with the formation of SOD1-containing inclusions, in FALS patients and the mutant SOD1-Tg mice. PMID: 21655264
  47. the toxin fusicoccin promotes binding of regulatory 14-3-3 proteins to glycoprotein Ibalpha and hampers binding to glycoprotein Ibbeta subunit. PMID: 21395556
  48. novel role for 14-3-3tau in the regulation of Beclin 1 expression and autophagy PMID: 20454448
  49. Depletion of Lats2 or 14-3-3gamma by siRNA inhibits P-body formation in response to UV. PMID: 21118956
  50. The study found that the 14-3-3 tau expression level with the formation of syncytiotrophoblast cells increased. PMID: 21046037
  51. Findings suggest that modulating the C-RAFSer(259)/14-3-3 protein-protein interaction with a stabilizing small molecule may yield a novel potential approach for treatment of diseases resulting from an overactive Ras-RAF-MAPK pathway. PMID: 20679480
  52. Data show that distinct phosphatases dephosphorylate conserved AKT motifs within the FOXO family and that PP2A is entwined in a dynamic interplay with AKT and 14-3-3 to directly regulate FOXO3a subcellular localization and transcriptional activation. PMID: 20110348
  53. Data suggest that 14-3-3 serves as a global inhibitor of centralspindlin that allows Aurora B to locally activate clustering and the stable accumulation of centralspindlin between segregating chromosomes. PMID: 20451386
  54. The 14-3-3 epsilon, zeta and theta may be involved in tumorigenesis of meningioma and be efficient markers for predicting the degree of malignancy in meningioma. PMID: 20388496
  55. The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum. PMID: 20308060
  56. RASSF1A-mediated cell death is, therefore, tightly controlled by 14-3-3 association. PMID: 20069457
  57. The findings of this studies strongly suggest a novel oncogenic role of 14-3-3tau by downregulating p21 in breast cancer. PMID: 20086099
  58. Upstream signals couple ASK2 S964 phosphorylation to the ASK1 signalosome through dual engagement of 14-3-3. PMID: 19935702
  59. IRSp53 binds to 14-3-3 after phosphorylation in a region that lies between the CRIB and SH3 domains PMID: 19933840
  60. Our findings define genetic markers in 14-3-3tau and CD44 that might improve the treatment and prognosis of soft-tissue sarcomas. PMID: 19996285
  61. 14-3-3beta, 14-3-3gamma, 14-3-3epsilon, 14-3-3eta and 14-3-3theta isoforms interact with the GPIb-IX complex in platelets PMID: 19558434
  62. Akt promotes cell-cycle progression through the mechanisms of phosphorylation-dependent 14-3-3 binding to p27(Kip1) and cytoplasmic localization. PMID: 12042314
  63. Data show that the Yes-associated protein (YAP) associates with 14-3-3 in an Akt-dependent manner. PMID: 12535517
  64. 14-3-3tau interacts with FSH receptor PMID: 15196694
  65. In transgenic mice with cardiac specific overexpression of dominant negative 14-3-3 protein, 14-3-3 negatively regulates cardiac hypertrophy and fibrosis, possibly through controlling expression of protein kinase C beta 2 in the diabetic myocardium. PMID: 15930726
  66. COPI and 14-3-3 specifically bind to the GB1 RSR sequence and that COPI is involved in its intracellular retention PMID: 16176975
  67. The 14-3-3 protein forms molecular complex with Hsp60 and PrPC in human CNS under physiological conditions, and this complex might become disintegrated in pathologic process of prion diseases. PMID: 16215457
  68. There is a direct functional role for the 14-3-3tau:Tir interaction in E.coli infection. PMID: 16367866
  69. In summary, our results show a direct interaction between CPAP and 14-3-3, and this interaction appears to be phosphorylation and cell cycle dependent. PMID: 16516142
  70. CSF 14-3-3 assay may represent a useful biologic marker in patients with Guillain-Barre syndrome. PMID: 17190946
  71. Regulation of AS160 and interaction with 14-3-3 in skeletal muscle are influenced by resistance exercise and insulin but do not fully explain the effect of resistance exercise on whole-body insulin action. PMID: 17369524
  72. ZNF198-FGFR1 activated prosurvival signaling pathways, resulting in elevated phosphorylation of FOXO3a. The phosphorylated residues subsequently sequestered the proapoptotic FOXO3a and BAD to 14-3-3 to prevent apoptosis PMID: 17389761
  73. AS160 is a common target of insulin, IGF-1, EGF, PMA and AICAR, these stimuli induce distinctive patterns of phosphorylation and 14-3-3 binding, mediated by at least four protein kinases. PMID: 17617058
  74. 14-3-3 proteins could play a role in consolidating and strengthening the effects of phosphorylation on TPH2 and that they may be important for the regulation of serotonin function in the nervous system PMID: 17973628
  75. Significant autoantibody reactivity against 14-3-3 theta was also observed in a set consisting of 18 prediagnostic lung cancer sera. PMID: 18089831
  76. activation of mTORC1 signalling by phorbol esters does not require PRAS40 to be phosphorylated at Thr(246), bind to 14-3-3 or be released from mTORC1. PMID: 18215133
  77. Therefore, our results suggest that the interaction between Sirt2 and 14-3-3 beta/gamma is a novel mechanism for the negative regulation of p53 beside the well-characterized Mdm2-mediated repression. PMID: 18249187
  78. the phosphorylation of beta2 integrins on Thr758 acts as a molecular switch to inhibit filamin binding and allow 14-3-3 protein binding to the integrin cytoplasmic domain, thereby modulating T-cell adhesion PMID: 18550856
  79. These proteins are important diagnostic biomarkers for CJD, especially in patients with negative 14-3-3 protein findings. PMID: 18626620
  80. 14-3-3 exerts combined effects on hMex-3B and acts as a major regulator of the sorting between distinct classes of RNA granules PMID: 18779327
  81. Report the occurrence of autoantibodies to annexin I, 14-3-3 theta and LAMR1 in prediagnostic lung cancer sera. PMID: 18794547
  82. Analysis of a series of HDAC4 mutants by nuclear import assay suggested that phosphorylation and subsequent 14-3-3 binding reduce nuclear import rather than enhancing nuclear export. PMID: 18952052
  83. 14-3-3 protein, together with amino- and carboxyl-terminal sorting signals, control the intracellular traffic of TWIK-related acid-sensitive K+ channel protein (TASK)-1 and TASK-3. PMID: 19139046
  84. changes in the expression of five 14-3-3 isoforms (beta, gamma, epsilon, tau, and zeta) during the apoptosis of JURL-MK1 and K562 cells. PMID: 19173300
  85. The model of the complex suggests that the forkhead domain of FOXO4 is docked within the central channel of the 14-3-3 protein dimer, consistent with the hypothesis that 14-3-3 masks the DNA binding interface of FOXO4. PMID: 19416966
  86. 3CTS contact targeting sequence is involved in the modulation of translocation via its 14-3-3-binding site, in cytoplasmic desequestration via the alpha-helix, and in selective PKCepsilon targeting at the cell-cell contact via Glu-374 PMID: 19429675
  87. Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and cell death in neurons. PMID: 19592491
  88. analysis of the interaction between 14-3-3 proteins, the N-terminal region of tyrosine hydroxylase, and negatively charged membranes PMID: 19801645

Show More

Hide All

Subcellular Location Cytoplasm
Protein Families 14-3-3 family
Tissue Specificity Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Database Links

HGNC: 12854

OMIM: 609009

KEGG: hsa:10971

STRING: 9606.ENSP00000238081

UniGene: Hs.74405

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1