Recombinant Human 14-3-3 protein theta(YWHAQ)

Code CSB-EP026290HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P27348
Relevance Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 14-3-3 protein T-cell 14-3-3 protein tau Protein HS1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Research Area Neuroscience
Source E.coli
Gene Names YWHAQ
Protein Names Recommended name: 14-3-3 protein theta Alternative name(s): 14-3-3 protein T-cell 14-3-3 protein tau Protein HS1
Expression Region 1-245aa
Tag Info N-terminal GST-tagged
Mol. Weight 54.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Subcellular Location Cytoplasm
Protein Families 14-3-3 family
Tissue Specificity Abundantly expressed in brain, heart and pancreas, and at lower levels in kidney and placenta. Up-regulated in the lumbar spinal cord from patients with sporadic amyotrophic lateral sclerosis (ALS) compared with controls, with highest levels of expression
Database Links

HGNC: 12854

OMIM: 609009

KEGG: hsa:10971

STRING: 9606.ENSP00000238081

UniGene: Hs.74405

Pathway Hippo signaling pathway
PI3K-Akt signaling pathway
Cell cycle

Related Products

YWHAQ Antibodies

YWHAQ Antibodies for Homo sapiens (Human)

YWHAQ Antibodies for Human

YWHAQ Proteins

YWHAQ Proteins for Homo sapiens (Human)

YWHAQ ELISA Kit

YWHAQ ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.