Home
Protein
Recombinant Proteins
Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14)

Recombinant Human 26S proteasome non-ATPase regulatory subunit 14 (PSMD14)

^{In Stock}

Citations (1)

Code	CSB-BP018904HU
Abbreviation	Recombinant Human PSMD14 protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Citations
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

PSMD14

Uniprot No.

O00487

Research Area

Cell Biology

Alternative Names

26S proteasome non-ATPase regulatory subunit 14; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; 26S proteasome-associated PAD1 homolog; PAD1; PAD1, yeast, homolog of; POH1; Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; Proteasome 26S subunit non ATPase 14; PSDE_HUMAN; Psmd14; RPN11; Testis tissue sperm binding protein Li 69n

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

1-310aa

Target Protein Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

79.2 kDa

Protein Length

Full Length

Tag Info

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human PSMD14 was expressed with the amino acid range of 1-310. The calculated molecular weight for this PSMD14 protein is 79.2 kDa. Expression of this PSMD14 protein is conducted in baculovirus. The N-terminal MBP tag and C-terminal 6xHis tag was fused into the coding gene segment of PSMD14, making it easier to detect and purify the PSMD14 recombinant protein in the later stages of expression and purification.

Research on PSMD14 (26S proteasome non-ATPase regulatory subunit 14) covers multiple areas. Many researchers focus on the precise regulatory mechanisms of PSMD14 in the 26S proteasome, including its position in degradation pathways and interactions with other subunits. Meanwhile, the role of PSMD14 in diseases is a significant area of interest, particularly in cancer and neurodegenerative disorders. These studies contribute to a deeper understanding of the biological functions of PSMD14, offering new directions for the treatment of related diseases.

Citations

Thiolutin Derivatives as Psmd14/Hdac Dual-Target Inhibitors Against Esophageal Cancer G He, Z Wu, X Yang, X Luo, L Zhang, Z Du, S Li,Available at SSRN 4995124,/

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. The PSMD14 subunit is a metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains within the complex. Plays a role in response to double-strand breaks (DSBs): acts as a regulator of non-homologous end joining (NHEJ) by cleaving 'Lys-63'-linked polyubiquitin, thereby promoting retention of JMJD2A/KDM4A on chromatin and restricting TP53BP1 accumulation. Also involved in homologous recombination repair by promoting RAD51 loading.

Gene References into Functions

overexpression of RPN11 in breast cancer tissues was associated with an advanced clinical stage. Patients with tumors with high expression of RPN11 had worse prognosis. PMID: 28535005
Deubiquitylase POH1 stabilizes E2F1 protein through binding to and deubiquitylating E2F1 in liver cancer. PMID: 26510456
The data demonstrated that proteasomal POH1 is a key de-ubiquitinating enzyme that regulates ubiquitin conjugates generated in response to damage and that several aspects of the DNA double-strand break response are regulated by the proteasome. PMID: 22909820
Disorder of POH1 expression is involved in the onset of idiopathic nephrotic syndrome (INS), and confers multidrug resistance in children with INS PMID: 19419512
Down-regulation of PSMD14 results in decreased cell proliferation, cell cycle arrest and senescence. A comparative study with PSMB5, revealed that PSMB5 and PSMD14 have different effects on cell cycle, senescence and associated molecular events. PMID: 19732767
Ectopic expression of POH1 in HEK293 cells decreased the level of c-Jun ubiquitination, leading to significant accumulation of the protein and a corresponding increase in AP1-mediated gene expression PMID: 16569633
An intact zinc metalloproteinase motif of Poh1 is essential for cell viability and 26S proteasome function. PMID: 17237285
Specificity for K63-linked polyubiquitin is a common property of the JAMM/MPN+ family of deubiquitinating enzymes. PMID: 19214193