Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
26S proteasome non-ATPase regulatory subunit 14; 26S proteasome regulatory subunit rpn11; 26S proteasome-associated PAD1 homolog 1; 26S proteasome-associated PAD1 homolog; PAD1; PAD1, yeast, homolog of; POH1; Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; Proteasome 26S subunit non ATPase 14; PSDE_HUMAN; Psmd14; RPN11; Testis tissue sperm binding protein Li 69n
Species
Homo sapiens (Human)
Expression Region
1-310aa
Target Protein Sequence
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human PSMD14 was expressed with the amino acid range of 1-310. The calculated molecular weight for this PSMD14 protein is 79.2 kDa. Expression of this PSMD14 protein is conducted in baculovirus. The N-terminal MBP tag and C-terminal 6xHis tag was fused into the coding gene segment of PSMD14, making it easier to detect and purify the PSMD14 recombinant protein in the later stages of expression and purification.
Research on PSMD14 (26S proteasome non-ATPase regulatory subunit 14) covers multiple areas. Many researchers focus on the precise regulatory mechanisms of PSMD14 in the 26S proteasome, including its position in degradation pathways and interactions with other subunits. Meanwhile, the role of PSMD14 in diseases is a significant area of interest, particularly in cancer and neurodegenerative disorders. These studies contribute to a deeper understanding of the biological functions of PSMD14, offering new directions for the treatment of related diseases.