Recombinant Human 28S ribosomal protein S22, mitochondrial(MRPS22)

Code CSB-EP014908HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P82650
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names MRPS22
Protein Names Recommended name: 28S ribosomal protein S22, mitochondrial Short name= MRP-S22 Short name= S22mt
Expression Region 1-360aa
Tag Info N-terminal GST-tagged
Mol. Weight 68.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Involvement in disease Combined oxidative phosphorylation deficiency 5 (COXPD5)
Subcellular Location Mitochondrion
Protein Families Mitochondrion-specific ribosomal protein mS22 family
Database Links

HGNC: 14508

OMIM: 605810

KEGG: hsa:56945

STRING: 9606.ENSP00000310785

UniGene: Hs.745001

Related Products

MRPS22 Antibodies

MRPS22 Antibodies for Homo sapiens (Human)

MRPS22 Antibodies for Human

MRPS22 Proteins

MRPS22 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.