Recombinant Human 28S ribosomal protein S6, mitochondrial(MRPS6)

Code CSB-EP014937HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P82932
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK
Research Area others
Source E.coli
Gene Names MRPS6
Protein Names Recommended name: 28S ribosomal protein S6, mitochondrial Short name= MRP-S6 Short name= S6mt
Expression Region 1-125aa
Tag Info N-terminal GST-tagged
Mol. Weight 41.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Mitochondrion
Protein Families Bacterial ribosomal protein bS6 family
Database Links

HGNC: 14051

OMIM: 611973

KEGG: hsa:64968

STRING: 9606.ENSP00000382250

UniGene: Hs.302742

Related Products

MRPS6 Antibodies

MRPS6 Antibodies for Human

MRPS6 Proteins

MRPS6 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.