Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10)

Code CSB-EP860776HU
Abbreviation Recombinant Human HSD17B10 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HSD17B10
Uniprot No.
Research Area
Transcription
Alternative Names
17 beta hydroxysteroid dehydrogenase 10; 17 beta hydroxysteroid dehydrogenase type 10; 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17b HSD10; 3 hydroxy 2 methylbutyryl CoA dehydrogenase; 3 hydroxyacyl CoA dehydrogenase type 2; 3 hydroxyacyl CoA dehydrogenase type II; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; AB binding alcohol dehydrogenase; ABAD; Ads9; Amyloid beta binding polypeptide; Amyloid beta peptide binding alcohol dehydrogenase; Amyloid beta peptide binding protein ; Amyloid beta peptide binding protein; CAMR; DUPXp11.22; Endoplasmic Reticulum Amyloid Binding Protein; Endoplasmic reticulum associated amyloid beta peptide binding protein; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ER associated amyloid beta-binding protein; ERAB; HADH 2; HADH2; HCD 2; HCD2; HCD2_HUMAN; Hsd17b10; Hydroxyacyl CoA Dehydrogenase type II; Hydroxyacyl Coenzyme A dehydrogenase type II; Hydroxysteroid (17 beta) dehydrogenase 10 ; Mental retardation X linked syndromic 11 ; MHBD; Mitochondrial L3 Hydroxyacyl CoA Dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; MRPP2; MRX17; SCHAD; SDR5C1; Short chain dehydrogenase/reductase family 5C member 1; Short chain L 3 hydroxyacyl CoA dehydrogenase type 2; Short chain type dehydrogenase/reductase XH98G2; Short-chain type dehydrogenase/reductase XH98G2; Type 10 17b HSD; Type 10 17beta hydroxysteroid dehydrogenase; Type II HADH; XH98G2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-261aa
Target Protein Sequence
AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) is expressed in E. coli and contains the complete mature protein sequence covering amino acids 2-261. An N-terminal 6xHis-SUMO tag is attached to help with purification and stability. SDS-PAGE analysis shows the product achieves greater than 90% purity, which appears to make it reliable for research work.

HSD17B10 protein serves an important function in mitochondrial pathways. It's involved in fatty acid oxidation and steroid metabolism processes. The enzyme is essential for breaking down various substrates - this includes branched-chain amino acids and neuroactive steroids. Given its central role in metabolic pathways, the protein has become a key target for biochemical and medical research, particularly for studies examining mitochondrial function and metabolic disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human HSD17B10 is expressed in E. coli, a prokaryotic system that is generally suitable for producing soluble enzymatic proteins like HSD17B10. As a mitochondrial dehydrogenase, HSD17B10 is a relatively small (261aa) soluble enzyme that does not require complex post-translational modifications for its catalytic activity. The protein is expressed as the full-length mature form (2-261aa) with an N-terminal 6xHis-SUMO tag and >90% purity. The SUMO tag may enhance solubility and proper folding. However, since activity is explicitly unverified and the protein requires precise folding for its dehydrogenase activity and NAD+ cofactor binding, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its enzymatic activity using appropriate substrates.

1. Protein-Protein Interaction Studies Using His-Tag Affinity Purification

The N-terminal 6xHis-SUMO tag enables technical feasibility for pull-down assays. However, if HSD17B10 is misfolded, it may not interact physiologically with true binding partners. This dehydrogenase forms a homotetramer and requires proper oligomerization for some interactions. This application should only be pursued after confirming proper folding and tetramer formation through biophysical characterization.

2. Antibody Development and Validation

The recombinant HSD17B10 can serve as an effective immunogen for generating antibodies that recognize linear epitopes. The full-length sequence ensures comprehensive epitope coverage. Validation against native HSD17B10 from mammalian mitochondria is recommended to ensure physiological relevance.

3. Biochemical Characterization and Enzyme Kinetics Studies

Basic biochemical characterization is feasible, but enzyme kinetics studies require activity validation first. If HSD17B10 is misfolded, kinetic parameters (Km, Vmax) will be invalid. These studies should only follow confirmation of dehydrogenase activity using known substrates (e.g., 3-hydroxyacyl-CoA derivatives).

4. Structural and Biophysical Analysis

This application is well-suited for initial characterization. Techniques like circular dichroism spectroscopy, analytical ultracentrifugation, and size-exclusion chromatography can assess folding state and oligomeric structure. These studies are valuable even before activity validation.

Final Recommendation & Action Plan

Given that HSD17B10 is a soluble enzyme expressed in a prokaryotic system with a solubility-enhancing SUMO tag, the probability of proper folding is relatively high. However, recommend first performing: 1) Functional validation using dehydrogenase activity assays with 3-hydroxyacyl-CoA substrates and NAD+ cofactor; 2) Biophysical characterization (size-exclusion chromatography with multi-angle light scattering) to confirm proper tetramer formation; 3) If possible, SUMO tag removal and comparison with tag-cleaved protein. Antibody development can proceed immediately. Avoid interaction studies until proper folding and oligomerization are confirmed. For reliable kinetic studies, use activity-verified protein and include appropriate controls.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial dehydrogenase involved in pathways of fatty acid, branched-chain amino acid and steroid metabolism. Acts as (S)-3-hydroxyacyl-CoA dehydrogenase in mitochondrial fatty acid beta-oxidation, a major degradation pathway of fatty acids. Catalyzes the third step in the beta-oxidation cycle, namely the reversible conversion of (S)-3-hydroxyacyl-CoA to 3-ketoacyl-CoA. Preferentially accepts straight medium- and short-chain acyl-CoA substrates with highest efficiency for (3S)-hydroxybutanoyl-CoA. Acts as 3-hydroxy-2-methylbutyryl-CoA dehydrogenase in branched-chain amino acid catabolic pathway. Catalyzes the oxidation of 3-hydroxy-2-methylbutanoyl-CoA into 2-methyl-3-oxobutanoyl-CoA, a step in isoleucine degradation pathway. Has hydroxysteroid dehydrogenase activity toward steroid hormones and bile acids. Catalyzes the oxidation of 3alpha-, 17beta-, 20beta- and 21-hydroxysteroids and 7alpha- and 7beta-hydroxy bile acids. Oxidizes allopregnanolone/brexanolone at the 3alpha-hydroxyl group, which is known to be critical for the activation of gamma-aminobutyric acid receptors (GABAARs) chloride channel. Has phospholipase C-like activity toward cardiolipin and its oxidized species. Likely oxidizes the 2'-hydroxyl in the head group of cardiolipin to form a ketone intermediate that undergoes nucleophilic attack by water and fragments into diacylglycerol, dihydroxyacetone and orthophosphate. Has higher affinity for cardiolipin with oxidized fatty acids and may degrade these species during the oxidative stress response to protect cells from apoptosis. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD). Essential for structural and functional integrity of mitochondria.; In addition to mitochondrial dehydrogenase activity, moonlights as a component of mitochondrial ribonuclease P, a complex that cleaves tRNA molecules in their 5'-ends. Together with TRMT10C/MRPP1, forms a subcomplex of the mitochondrial ribonuclease P, named MRPP1-MRPP2 subcomplex, which displays functions that are independent of the ribonuclease P activity. The MRPP1-MRPP2 subcomplex catalyzes the formation of N(1)-methylguanine and N(1)-methyladenine at position 9 (m1G9 and m1A9, respectively) in tRNAs; HSD17B10/MRPP2 acting as a non-catalytic subunit. The MRPP1-MRPP2 subcomplex also acts as a tRNA maturation platform: following 5'-end cleavage by the mitochondrial ribonuclease P complex, the MRPP1-MRPP2 subcomplex enhances the efficiency of 3'-processing catalyzed by ELAC2, retains the tRNA product after ELAC2 processing and presents the nascent tRNA to the mitochondrial CCA tRNA nucleotidyltransferase TRNT1 enzyme. Associates with mitochondrial DNA complexes at the nucleoids to initiate RNA processing and ribosome assembly.
Gene References into Functions
  1. Authors report two patients with novel missense mutations in the HSD17B10 gene (c.34G>C and c.526G>A), resulting in the p.V12L and p.V176M substitutions. Val12 and Val176 are highly conserved residues located at different regions of the MRPP2 structure. PMID: 28888424
  2. in addition to being an essential component of the RNase P reaction, MRPP1/2 serves as a processing platform for several down-stream tRNA maturation steps in human mitochondria. PMID: 29040705
  3. The S-nitrosation of a cysteine residue distal to the 3-hydroxyacyl-CoA dehydrogenase type 2 (HADH2) active site impaired catalytic activity. PMID: 27291402
  4. A computational study and enzyme inhibition assay with full length human 17-beta-HSD10 identifies risperidone as enzyme inhibitor and possible antineoplastic agent. PMID: 28188816
  5. Data suggest that HSD10 plays a role in alterations of energy metabolism by regulating mtDNA content in colorectal carcinomas. PMID: 26884257
  6. Our findings demonstrate that overexpression of HSD10 accelerates pheochromocytoma cell growth, enhances cell respiration, and increases cellular resistance to cell death induction. PMID: 25879199
  7. Three HSD10 variants associated with neurodegenerative disorders are inactive with cardiolipin PMID: 26338420
  8. The authors demonstrate elevated amounts of unprocessed pre-tRNAs and mRNA transcripts encoding mitochondrial subunits indicating deficient RNase P activity in HSD10 disease. PMID: 25575635
  9. The study showed that pathogenic mutations impair SDR5C1-dependent dehydrogenation, tRNA processing and methylation. PMID: 25925575
  10. loss of HSD10 causes impaired mitochondrial precursor transcript processing which may explain mitochondrial dysfunction observed in HSD10 disease PMID: 24549042
  11. Defects in this gene are a cause of 17beta-hydroxysteroid dehydrogenase type 10 (HSD10) deficiency. The encoded protein does not exhibit generalized alcohol dehydrogenase activity as was previously thought. PMID: 25007702
  12. Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue PMID: 24244276
  13. Inhibition of mitochondrial RNase P by beta-amyloid is an unspecific effect and is not mediated by beta-amyloid interaction with SDR5C1. PMID: 23755257
  14. Two major HSD17B10 transcription start sites were identified by primer extension at -37 and -6 as well as a minor start site at -12 nucleotides from the initiation codon ATG. PMID: 23834306
  15. A 5-methylcytosine is present in both active and inactive X chromosomes at + 2259 nucleotide from the initiation ATG of the HSD17B10 gene, explaining the prevalence of the p.R130C mutation among HSD10 deficiency patients. PMID: 23266819
  16. analysis of clinical consequences of mutations in the HSD17B10 gene PMID: 22127393
  17. The role of ABAD in amyloid beta toxicity, was investigated. PMID: 22174920
  18. behavioral stress causes protein up-regulation in the brain of a mouse model of Alzheimer disease PMID: 21382475
  19. These results suggest that the HSD17B10 gene does not escape X-inactivation as has been reported previously. PMID: 20664630
  20. HSD17B10 is regulated by several isoforms of C/EBP-beta in HepG2 cells. PMID: 20638476
  21. This finding indicates that the symptoms in patients with mutations in the HSD17B10 gene are unrelated to accumulation of toxic metabolites in the isoleucine pathway and, rather, related to defects in general mitochondrial function. PMID: 20077426
  22. Sequence analysis of the HADH2 gene from patients with MHBD deficiency revealed the presence of two missense mutations (R130C and L122V)which almost completely abolish enzyme activity PMID: 12696021
  23. Comparison of substrate specificity of human and Drosophila melanogaster type 10 17b-hydroxysteroid dehydrogenases PMID: 12917011
  24. Abeta interacts with ABAD in the mitochondria of Alzheimer's disease patients and transgenic mice; data suggest that the ABAD-Abeta interaction may be a therapeutic target in Alzheimer's disease PMID: 15087549
  25. crystal structure of ABAD/HSD10 complexed with NAD(+) and an inhibitory small molecule PMID: 15342248
  26. findings link amyloid-beta peptide (Abeta) binding alcohol dehydrogenase (ABAD)-induced oxidant stress to critical aspects of Alzheimer's disease (AD)-associated cellular dysfunction, suggesting a pivotal role for this enzyme in the pathogenesis of AD PMID: 15665036
  27. Brain astrocytes contain a moderate level of 17beta-HSD10, which is elevated in activated astrocytes of brains with Alzheimer type pathology, including sporadic Alzheimer's disease (AD) and Down syndrome with AD. PMID: 15804423
  28. Reduced expression of the HADH2 protein causes MRXS10, a phenotype different from that caused by 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency, which is a neurodegenerative disorder caused by missense mutations in this multifunctional protein. PMID: 17236142
  29. These results propose an additional role of ABAD in neural cell death in AD. PMID: 17707551
  30. Data suggest that thioredoxin could not only assist ABAD-inhibiting peptide expression, but rebalance the disturbed "redox equilibrium" caused by intracellular amyloid beta in PC12 cells. PMID: 17917077
  31. Increased gene dosage of HSD17B10, HUWE1, or both contribute to the etiology of X-Linked Mental Retardation. PMID: 18252223
  32. In Alzheimer disease and schizophrenia, significant shifts to left/right asymmetry were found and the changes were associated with more marked increases in mRNA/enzyme expression in the left hemisphere PMID: 18765932
  33. Up-rulation of HSD17B10 expression is associated with poor response to chemotherapy in conventional osteosarcomas. PMID: 19449377
  34. Amyloid-beta-peptide binding to mitochondrial Abeta-binding alcohol dehydrogenase (ABAD) enzyme triggers a series of events leading to mitochondrial dysfunction characteristic of Alzheimer's disease. PMID: 19601895
  35. results support the theory that an imbalance in neurosteroid metabolism could be a major cause of the neurological handicap associated with hydroxysteroid (17beta) dehydrogenase 10 deficiency. PMID: 19706438
  36. The data indicated pronounced increases in the 17beta-hydroxysteroid dehydrogenase type 10 levels, specifically to 179% in multiple sclerosis and to 573% in Alzheimer disease when compared to the age-matched controls. PMID: 19756307
  37. Here, we demonstrate that Abeta-binding alcohol dehydrogenase (ABAD) is a direct molecular link from Abeta to mitochondrial toxicity. PMID: 15087549
  38. tissue distribution, subcellular localization, and metabolic functions PMID: 11559359

Show More

Hide All

Involvement in disease
HDS10 mitochondrial disease (HSD10MD); Mental retardation, X-linked 17 (MRX17)
Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity
Ubiquitously expressed in normal tissues but is overexpressed in neurons affected in AD.
Database Links

HGNC: 4800

OMIM: 300256

KEGG: hsa:3028

STRING: 9606.ENSP00000168216

UniGene: Hs.171280

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*