Recombinant Human RNA-binding protein RO60 (RO60), partial

In Stock
Code CSB-EP025071HU1
Abbreviation Recombinant Human RO60 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TROVE2
Uniprot No.
Alternative Names
60 kDa ribonucleoprotein Ro; 60 kDa Ro protein; 60 kDa SS A/Ro ribonucleoprotein; 60 kDa SS-A/Ro ribonucleoprotein; Autoantigen Ro/SSA, 60-KD; bA101E13.2; Gastric cancer multi drug resistance protein; Ribonucleoprotein autoantigen SS A/Ro; RO 60; Ro 60 kDa autoantigen; RO60; RO60_HUMAN; RoRNP; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2; SS A; SS-A; SS-A/Ro; SSA 2; SSA; SSA2; TROVE 2; TROVE domain family member 2; TROVE2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-535aa
Target Protein Sequence
ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance.
Gene References into Functions
  1. TROVE2 is a novel target of miR-128 in astrocytoma tissues and the expression of TROVE2 is increased with the pathological stages increasing. PMID: 26307612
  2. Significant relationships were found between clinical and laboratory manifestations of autoimmune and rheumatic diseases with different patterns of antibodies to anti-Ro52, anti-Ro60 and anti-La. PMID: 26725021
  3. These findings establish a link among the lupus autoantigen Ro60, Alu retroelements, and type I interferon. PMID: 26382853
  4. Findings indicate a relentless turnover of short-lived clonotypic variants, masquerading as long-lived Ro60 humoral autoimmunity. PMID: 23644453
  5. The Y3 RNA moiety of the Ro60 ribonucleoprotein plays a critical role in the pathogenesis of fetal cardiac injury by altering the subcellular location of Ro60 autoantibodies. PMID: 23698747
  6. these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei. PMID: 22114317
  7. conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs PMID: 21060685
  8. dichotomy of human autoantibody responses against mutually exclusive determinants linked to a single domain of a systemic autoantigen and supports a model in which tolerance is broken by different immunogenic forms of Ro 60 PMID: 20131295
  9. Activation of Toll-like receptors by fetal factor Ro60-associated single-stranded RNA particles is relevant in autoimmune-associated congenital heart block, where the obligate maternal factor is an anti-SSA/Ro autoantibody. PMID: 20089705
  10. In viitro RNA chaperone activity of SSA2 was studied. PMID: 15928345
  11. The structural organization and Zn2+-dependent subdomain interactions involving autoiantigenic epitopes in the RBBC region of SS-A were studied. PMID: 15964842
  12. interactions between Ro-Y5 and L5-5S RNPs establish 5S RNA as a target of quality control PMID: 18056422
  13. results demonstrate that Ro 60 functions as a novel receptor for beta(2)GPI on the surface of apoptotic cells. The formation of Ro 60-beta(2)GPI complexes may protect against anti-Ro 60 autoantibody-mediated tissue injury. PMID: 19248095

Show More

Hide All

Subcellular Location
Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Protein Families
Ro 60 kDa family
Database Links

HGNC: 11313

OMIM: 600063

KEGG: hsa:6738

STRING: 9606.ENSP00000356411

UniGene: Hs.288178

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*