Recombinant Human ADP-ribosylation factor 1(ARF1)

In Stock
Code CSB-EP001988HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ARF1
Uniprot No. P84077
Research Area Signal Transduction
Alternative Names ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN
Species Homo sapiens (Human)
Source E.coli
Expression Region 2-181aa
Target Protein Sequence GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 50.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasicity of excitatory synapses and spine shrinkage during long-term depression (LTD).
Gene References into Functions
  1. Coincident with the loss of PICK1 by GBF1-activated ARF1, CDC42 recruitment leads to the activation of IRSp53 and the ARP2/3 complex, resulting in a burst of F-actin polymerisation potentially powering scission. PMID: 29743604
  2. This study suggests that simultaneous blockade of Arf1 and Ras activation in prostate cancer cells is a potential targeted therapeutic strategy for preventing prostate cancer development. PMID: 28830537
  3. Silencing of ARF1 impaired RAC1 recruitment to leading edge in neutrophil chemotaxis. PMID: 28969640
  4. Data show that only ADP-ribosylation factor 1 (ARF1) promoter hypermethylation was significantly associated with epidermal growth factor receptor gene (EGFR) gene amplification in glioblastoma. PMID: 28631186
  5. The zebrafish-metastasis model confirms that the ARF1 gene depletion suppresses breast cancer cells to metastatic disseminate throughout fish body. PMID: 27517156
  6. ARF1 is a critical regulator in prostate cancer progression PMID: 27213581
  7. our findings demonstrate that ARF1 is a molecular switch for cancer progression and thus suggest that limiting the expression/activation of this GTPase could help improve outcome for breast cancer patients. PMID: 26908458
  8. changes in distinct lipid ratios may converge on ARF1 to increase SBP-1/SREBP-1 activity. PMID: 27320911
  9. Experiments using a mutant form of ARF1 affecting GTP hydrolysis suggest that ARF1[GTP] is functionally required for the tubules to form. PMID: 28428254
  10. ARNO-ARF1 regulates formation of podosomes by inhibition of RhoA/myosin-II and promotion of actin core assembly. PMID: 28007915
  11. ARF1 may reverse CAM-DR by regulating phosphorylation of p27 at T157 in MM. our data shed new light on the molecular mechanism of CAM-DR in MM, and targeting ARF1 may be a novel therapeutic approach for improving the effectiveness of chemotherapy in MM. PMID: 28238095
  12. We report here that 2-methylcoprophilinamide (M-COPA), a compound that induces disassembly of the Golgi apparatus by inactivating ADP-ribosylation factor 1 (Arf1), suppresses Stx-induced apoptosis. M-COPA inhibited transport of Stx from the plasma membrane to the Golgi apparatus and suppressed degradation of anti-apoptotic proteins and the activation of caspases PMID: 27302278
  13. observations indicate that Arf1 and Arf3 as well as Arf6 play important roles in cytokinesis. PMID: 26330566
  14. ARF1 activates the MAPK pathway likely using the Golgi as a main platform, which in turn activates the cytoplasmic RSK1, leading to cell proliferation. PMID: 26169956
  15. Data indicate that ADP-ribosylation factor 1 (Arf1) colocalizes with chromogranin A and regulates secretion of insulin like growth factor 1 (IGF-1) and is required for anchorage dependent growth. PMID: 25754106
  16. this study reports the cryo-electron microscopy structures of the Nef- and Arf1-bound AP-1 trimer in the active and inactive states. PMID: 26494761
  17. Suggest a model in which Arf1/COPI machinery acts to control endoplasmic reticulum-lipid droplet connections for localization of key enzymes of triglyceride storage and catabolism. PMID: 24497546
  18. ARF1 regulates cellularmigration of highly invasive triple-negative breast cancer cells, through the regulation of the focal adhesions complex. PMID: 25530216
  19. Class I ADP-ribosylation factors are involved in enterovirus 71 replication. PMID: 24911624
  20. Myristoylome profiling reveals a concerted mechanism of ARF GTPase deacylation by the Shigella protease IpaJ. PMID: 25773595
  21. Study adds to the expanding role for Arf1 in the periphery and identifies a requirement for Arf1, a "Golgi Arf," in the reorganization of the cortical actin cytoskeleton on ventral surfaces, against the substratum. PMID: 24916416
  22. Structural modeling and cellular studies show that EspG induces bidirectional traffic arrest by tethering vesicles through select ARF1-GTP/effector complexes and local inactivation of Rab1. PMID: 24582959
  23. EFA6 is regulated by a negative feedback loop, which is mediated by an allosteric interaction of Arf6-GTP with a domain of EFA6 and monitors the activation of Arf1 and Arf6 differentially PMID: 25114232
  24. ARF1 is the first upstream GTPase activated by EGFR. PMID: 24196838
  25. a central role for adaptor proteins p66Shc and Grb2 in the regulation of ARF1 and ARF6 activation in invasive breast cancer cells. PMID: 24407288
  26. ARF1+ARF4 and ARF1+ARF3 are required for integrity of recycling endosomes but are involved in distinct transport pathways: regulates retrograde transport from endosomes to the TGN, and transferrin recycling pathway from endosomes to the plasma membrane. PMID: 23783033
  27. Inhibition of ARF1 or Rac1 expression markedly impacts the ability of MDA-MB-231 cells to migrate upon Epidermal Growth Factor stimulation. PMID: 23707487
  28. ARF1 and ARF3 are redundantly required for the integrity of recycling endosomes PMID: 22971977
  29. chemokine unresponsiveness in chronic lymphocytic leukemia lymphocytes results from failure of Arf1/phospholipase D1-mediated translocation of Rap1 to the plasma membrane for GTP loading and may be a specific feature of anergy induced by DNA Ags. PMID: 23804711
  30. Arf modulates LRP6 phosphorylation for the transduction of Wnt/beta-catenin signaling. PMID: 22907437
  31. Kinetics of interaction between ADP-ribosylation factor-1 (Arf1) and the Sec7 domain of Arno guanine nucleotide exchange factor, modulation by allosteric factors, and the uncompetitive inhibitor brefeldin A PMID: 23255605
  32. Study solved the crystal structure of the AP-1 core in complex with GTP-bound Arf1. The most important insight is that Arf1-GTP alone, in the absence of cargo or phosphatidylinositol-4-phosphate, can unlock AP-1 and drive it into the open conformation. PMID: 23415225
  33. Secretion of soluble vascular endothelial growth factor receptor 1 (sVEGFR1/sFlt1) requires Arf1, Arf6, and Rab11 GTPases. PMID: 22962618
  34. a novel molecular mechanism of circular dorsal ruffles ring size control through the ARAP1-Arf1/5 pathway. PMID: 22573888
  35. GBF1-mediated Arf1 activation is necessary to unify cell polarity during chemotaxis PMID: 22573891
  36. ARF1-overexpressing clones display enhanced cell proliferation, migration, and invasion. Furthermore, ARF1-overexpression might contribute to poor prognosis of gastric carcinoma patients. PMID: 22348287
  37. the vesicular transport proteins ARF1 and GBF1 colocalized with PI4KIIIbeta and were both required for HCV replication PMID: 22359663
  38. Arl1 acts to direct a trans-Golgi-specific Arf1 guanine nucleotide exchange factor, and hence active Arf1, to the trans side of the Golgi. PMID: 22291037
  39. AMF-26 is a novel anticancer drug candidate that inhibits the Golgi system, targeting Arf1 activation. PMID: 22158626
  40. A dimerization-deficient Arf1 mutant, which does not display the ability to modulate membrane curvature in vitro or to drive formation of coated vesicles, is able to recruit coatomer to allow formation of COPI-coated buds but does not support scission. PMID: 21893600
  41. GBF1 and ATGL interact directly and in cells, through multiple contact sites on each protein. PMID: 21789191
  42. ARF1 controls proliferation of breast cancer cells by regulating the retinoblastoma protein PMID: 21478909
  43. Arf GTPases may be central components in WAVE signalling, acting directly, alongside Rac1. PMID: 21844371
  44. Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain. PMID: 21454700
  45. Arf1 regulates PLA2G6-A activity together with Arf4; and gene silencing of Arf1 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway. PMID: 20881058
  46. These data provide novel insights into the role of Arf1 in the regulation of viral RNA replication and the production of infectious hepatitis C virus. PMID: 21068255
  47. Insight into the role of dynamics in the conformational switch of the small GTP-binding protein Arf1. PMID: 20861011
  48. Vascular endothelial growth factor receptor-2 activates ADP-ribosylation factor 1 to promote endothelial nitric-oxide synthase activation and nitric oxide release from endothelial cells PMID: 20529868
  49. Data suggest a novel model in which ARF1 recruits PKD2 to the TGN by binding to Pro275 in its C1b domain followed by anchoring of PKD2 in the TGN membranes via binding of its C1a domain to diacylglycerol. PMID: 20089835
  50. Data demonstrate a key role of Rab and Arf family small GTPases and intracellular trafficking in mTORC1 activation. PMID: 20457610
  51. analysis of how modifications to the C-terminus of Arf1 alter cell functions and protein interactions PMID: 20214751
  52. Protein complexes containing CYFIP/Sra/PIR121 coordinate Arf1 and Rac1 signalling during clathrin-AP-1-coated carrier biogenesis at the trans-golgi network. PMID: 20228810
  53. The authors demonstrate that Rab1b-activated GBF1 and ARF1 are involved in Ebolavirus virion formation, suggesting that both the COPII and COPI transport systems play a role in Ebolavirus VP40-mediated particle formation. PMID: 20164217
  54. A senescence rescue screen identifies BCL6 as an inhibitor of anti-proliferative p19(ARF)-p53 signaling PMID: 11914273
  55. ARF1 has a role in phospholipase D activation by the M3 muscarinic receptor PMID: 12799371
  56. human ARF tumor suppressor binds to Tat-binding protein-1 and has a role in control of cell proliferation PMID: 14665636
  57. Overexpression of SPN causes activation of the tumor suppressor protein ARF1. PMID: 14676827
  58. crystal structure of the ARF1*GDP*Sec7*Brefeldin A (BFA)complex shows that BFA binds at the protein-protein interface to inhibit conformational changes in ARF1 required for Sec7 to dislodge the GDP molecule PMID: 14690595
  59. Results from NMR experiments presented on ADP-ribosylation factor 1 (Arf1).GDP and Delta17Arf1.GDP in solution reveal substantial structural differences that can only be associated with N-terminal truncation. PMID: 15308674
  60. Binding of Arf1 to phosphatidylinositol (4,5) bisphosphate can promote the nucleotide exchange process and facilitate activation of Arfs with associated conformational changes and possible alteration in position and stability of Arf1 N-terminal helix. PMID: 15581351
  61. Arf1 mRNA is a natural target for Stau1-mediated decay, and data indicate that other mRNAs are also natural targets. PMID: 15680326
  62. These studies suggest that membrin recruits Arf-1 to the early Golgi and reveal distinct kinetic cycles for Arf-1 at early and late Golgi determined by different sets of Arf regulators and effectors. PMID: 15781476
  63. The ADP-Ribosylation Factor 1 acts as a master regulator of Golgi structure and function through the recruitment and activation of various downstream effectors. PMID: 15793564
  64. CTLA-4 may be stored in a specialized compartment in regulatory T cells that can be triggered rapidly for deployment to the plasma membrane in a phospholipase D- and ADP ribosylation factor-1-dependent manner PMID: 15814706
  65. MdmX can affect post-translational modification and stability of Mdm2 and p53 activity through interaction with ARF PMID: 15876864
  66. Analysis of the four possible conformations of the human ARF1 N-terminal peptide by molecular dynamics simulations to distinguish which of the four possible membrane bound structures was the most likely. PMID: 16308272
  67. N376 to D mutation in the conserved NPxxY motif within the carboxy terminal tail domain (CT) of the 5-HT2A receptor alters the binding preference of GST-fusion protein constructs of the CT domain from ARF1 to an alternative isoform, ARF6. PMID: 16545942
  68. A phosphatidylinositol-3-kinase-dependent signal transition defines the sequence of ARF1 activation during phagocytosis. PMID: 16669702
  69. Data show that the architecture of the vimentin cytoskeleton is modified by perturbation of the GTPase ARF1. PMID: 16912072
  70. Arf1-GTP-ASAP1 undergoes a significant conformational change when transitioning from the ground to catalytically active state PMID: 17112341
  71. Coatomer is linked to the Golgi through multiple interfaces with membrane-bound Arf1-GTP. PMID: 17451557
  72. Enhanced the stimulatory effect of 1-Phosphatidylinositol 4-Kinase on regulated exocytosis. PMID: 17555535
  73. p24A is a regulator of signal-dependent trafficking that controls ARF1-dependent resensitization of PAR-2 PMID: 17693410
  74. These results suggest that KIAA1110 is expressed specifically in mature neurons and may play an important role in the secretion pathway as a GEF for ARF1. PMID: 17981261
  75. siRNAs demonstrate that GBF1-mediated ARF1 activation is required for efficient MHV RNA replication PMID: 18551169
  76. Arf1 and Arf6 were shown to load GTP in a membrane-curvature-dependent manner and stabilize, or further facilitate, changes in membrane curvature through the insertion of an amphipathic helix. PMID: 18597672
  77. Arf1-GTP induces positive membrane curvature and find that the small GTPase can dimerize dependent on GTP PMID: 18689681
  78. Arf1-GTP-induced tubule formation suggests a function of Arf family proteins in curvature acquisition at sites of vesicle budding. PMID: 18693248
  79. ARF1 regulates epidermal growth factor-dependent breast cancer cell growth and invasion during cancer progression by controlling the activation of the phosphatidylinositol 3-kinase pathway PMID: 18990689
  80. present the structure of a myristoylated ARF1 protein, determined by solution NMR methods, and an assessment of the influence of myristoylation on association of ARF1.GDP and ARF1.GTP with lipid bilayers PMID: 19141284
  81. ARF1 may play a critical role in clathrin-mediated cholera toxin (CT) trafficking through the endoplasmic reticulum and Golgi and ARF6 may facilitate clathrin-mediated CT endocytosis that leads to enhanced Gs(alpha) activation by CT. PMID: 19359423

Show More

Hide All

Subcellular Location Golgi apparatus, Cytoplasm, perinuclear region, Cell junction, synapse, synaptosome, Cell junction, synapse, postsynaptic cell membrane, postsynaptic density, Membrane, Lipid-anchor
Protein Families Small GTPase superfamily, Arf family
Database Links

HGNC: 652

OMIM: 103180

KEGG: hsa:375

STRING: 9606.ENSP00000272102

UniGene: Hs.286221

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1