Recombinant Human ADP-ribosylation factor 1 (ARF1)

In Stock
Code CSB-EP001988HU
Abbreviation Recombinant Human ARF1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
ADP Ribosylation Factor 1; ADP-ribosylation factor 1; ARF 1; ARF1; ARF1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-181aa
Target Protein Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-181 constitute the expression domain of recombinant Human ARF1. The calculated molecular weight for this ARF1 protein is 55.7 kDa. This ARF1 recombinant protein is manufactured in e.coli. The N-terminal 10xHis-GST tag and C-terminal Myc tag was fused into the coding gene segment of ARF1, making it easier to detect and purify the ARF1 recombinant protein in the later stages of expression and purification.

ADP-ribosylation factor 1 (ARF1) is a critical protein involved in intracellular membrane transport and signal transduction. Some studies indicates that ARF1 plays a crucial role in the highly dynamic endoplasmic reticulum-Golgi apparatus-cell membrane system. Actually, ARF1 stands out for its role in controlling the secretion pathway. As a GTPase, ARF1 controls the formation and fusion of intracellular membrane vesicles by transitioning between active and inactive states on the membrane. This is vital for fundamental cellular processes such as intracellular protein transport, secretion, and endocytosis. In addition, ARF1 is implicated in regulating the dynamic balance of the cell cytoskeleton and cell polarity. It influences the invasion and metastasis of tumor cells and plays a role in synapse formation in neurons.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GTP-binding protein involved in protein trafficking among different compartments. Modulates vesicle budding and uncoating within the Golgi complex. Deactivation induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, suggesting a crucial role in protein trafficking. In its GTP-bound form, its triggers the association with coat proteins with the Golgi membrane. The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles. The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasicity of excitatory synapses and spine shrinkage during long-term depression (LTD).; (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Gene References into Functions
  1. Coincident with the loss of PICK1 by GBF1-activated ARF1, CDC42 recruitment leads to the activation of IRSp53 and the ARP2/3 complex, resulting in a burst of F-actin polymerisation potentially powering scission. PMID: 29743604
  2. This study suggests that simultaneous blockade of Arf1 and Ras activation in prostate cancer cells is a potential targeted therapeutic strategy for preventing prostate cancer development. PMID: 28830537
  3. Silencing of ARF1 impaired RAC1 recruitment to leading edge in neutrophil chemotaxis. PMID: 28969640
  4. Data show that only ADP-ribosylation factor 1 (ARF1) promoter hypermethylation was significantly associated with epidermal growth factor receptor gene (EGFR) gene amplification in glioblastoma. PMID: 28631186
  5. The zebrafish-metastasis model confirms that the ARF1 gene depletion suppresses breast cancer cells to metastatic disseminate throughout fish body. PMID: 27517156
  6. ARF1 is a critical regulator in prostate cancer progression PMID: 27213581
  7. our findings demonstrate that ARF1 is a molecular switch for cancer progression and thus suggest that limiting the expression/activation of this GTPase could help improve outcome for breast cancer patients. PMID: 26908458
  8. changes in distinct lipid ratios may converge on ARF1 to increase SBP-1/SREBP-1 activity. PMID: 27320911
  9. Experiments using a mutant form of ARF1 affecting GTP hydrolysis suggest that ARF1[GTP] is functionally required for the tubules to form. PMID: 28428254
  10. ARNO-ARF1 regulates formation of podosomes by inhibition of RhoA/myosin-II and promotion of actin core assembly. PMID: 28007915
  11. ARF1 may reverse CAM-DR by regulating phosphorylation of p27 at T157 in MM. our data shed new light on the molecular mechanism of CAM-DR in MM, and targeting ARF1 may be a novel therapeutic approach for improving the effectiveness of chemotherapy in MM. PMID: 28238095
  12. We report here that 2-methylcoprophilinamide (M-COPA), a compound that induces disassembly of the Golgi apparatus by inactivating ADP-ribosylation factor 1 (Arf1), suppresses Stx-induced apoptosis. M-COPA inhibited transport of Stx from the plasma membrane to the Golgi apparatus and suppressed degradation of anti-apoptotic proteins and the activation of caspases PMID: 27302278
  13. observations indicate that Arf1 and Arf3 as well as Arf6 play important roles in cytokinesis. PMID: 26330566
  14. ARF1 activates the MAPK pathway likely using the Golgi as a main platform, which in turn activates the cytoplasmic RSK1, leading to cell proliferation. PMID: 26169956
  15. Data indicate that ADP-ribosylation factor 1 (Arf1) colocalizes with chromogranin A and regulates secretion of insulin like growth factor 1 (IGF-1) and is required for anchorage dependent growth. PMID: 25754106
  16. this study reports the cryo-electron microscopy structures of the Nef- and Arf1-bound AP-1 trimer in the active and inactive states. PMID: 26494761
  17. Suggest a model in which Arf1/COPI machinery acts to control endoplasmic reticulum-lipid droplet connections for localization of key enzymes of triglyceride storage and catabolism. PMID: 24497546
  18. ARF1 regulates cellularmigration of highly invasive triple-negative breast cancer cells, through the regulation of the focal adhesions complex. PMID: 25530216
  19. Class I ADP-ribosylation factors are involved in enterovirus 71 replication. PMID: 24911624
  20. Myristoylome profiling reveals a concerted mechanism of ARF GTPase deacylation by the Shigella protease IpaJ. PMID: 25773595
  21. Study adds to the expanding role for Arf1 in the periphery and identifies a requirement for Arf1, a "Golgi Arf," in the reorganization of the cortical actin cytoskeleton on ventral surfaces, against the substratum. PMID: 24916416
  22. Structural modeling and cellular studies show that EspG induces bidirectional traffic arrest by tethering vesicles through select ARF1-GTP/effector complexes and local inactivation of Rab1. PMID: 24582959
  23. EFA6 is regulated by a negative feedback loop, which is mediated by an allosteric interaction of Arf6-GTP with a domain of EFA6 and monitors the activation of Arf1 and Arf6 differentially PMID: 25114232
  24. ARF1 is the first upstream GTPase activated by EGFR. PMID: 24196838
  25. a central role for adaptor proteins p66Shc and Grb2 in the regulation of ARF1 and ARF6 activation in invasive breast cancer cells. PMID: 24407288
  26. ARF1+ARF4 and ARF1+ARF3 are required for integrity of recycling endosomes but are involved in distinct transport pathways: regulates retrograde transport from endosomes to the TGN, and transferrin recycling pathway from endosomes to the plasma membrane. PMID: 23783033
  27. Inhibition of ARF1 or Rac1 expression markedly impacts the ability of MDA-MB-231 cells to migrate upon Epidermal Growth Factor stimulation. PMID: 23707487
  28. ARF1 and ARF3 are redundantly required for the integrity of recycling endosomes PMID: 22971977
  29. chemokine unresponsiveness in chronic lymphocytic leukemia lymphocytes results from failure of Arf1/phospholipase D1-mediated translocation of Rap1 to the plasma membrane for GTP loading and may be a specific feature of anergy induced by DNA Ags. PMID: 23804711
  30. Arf modulates LRP6 phosphorylation for the transduction of Wnt/beta-catenin signaling. PMID: 22907437
  31. Kinetics of interaction between ADP-ribosylation factor-1 (Arf1) and the Sec7 domain of Arno guanine nucleotide exchange factor, modulation by allosteric factors, and the uncompetitive inhibitor brefeldin A PMID: 23255605
  32. Study solved the crystal structure of the AP-1 core in complex with GTP-bound Arf1. The most important insight is that Arf1-GTP alone, in the absence of cargo or phosphatidylinositol-4-phosphate, can unlock AP-1 and drive it into the open conformation. PMID: 23415225
  33. Secretion of soluble vascular endothelial growth factor receptor 1 (sVEGFR1/sFlt1) requires Arf1, Arf6, and Rab11 GTPases. PMID: 22962618
  34. a novel molecular mechanism of circular dorsal ruffles ring size control through the ARAP1-Arf1/5 pathway. PMID: 22573888
  35. GBF1-mediated Arf1 activation is necessary to unify cell polarity during chemotaxis PMID: 22573891
  36. ARF1-overexpressing clones display enhanced cell proliferation, migration, and invasion. Furthermore, ARF1-overexpression might contribute to poor prognosis of gastric carcinoma patients. PMID: 22348287
  37. the vesicular transport proteins ARF1 and GBF1 colocalized with PI4KIIIbeta and were both required for HCV replication PMID: 22359663
  38. Arl1 acts to direct a trans-Golgi-specific Arf1 guanine nucleotide exchange factor, and hence active Arf1, to the trans side of the Golgi. PMID: 22291037
  39. AMF-26 is a novel anticancer drug candidate that inhibits the Golgi system, targeting Arf1 activation. PMID: 22158626
  40. A dimerization-deficient Arf1 mutant, which does not display the ability to modulate membrane curvature in vitro or to drive formation of coated vesicles, is able to recruit coatomer to allow formation of COPI-coated buds but does not support scission. PMID: 21893600
  41. GBF1 and ATGL interact directly and in cells, through multiple contact sites on each protein. PMID: 21789191
  42. ARF1 controls proliferation of breast cancer cells by regulating the retinoblastoma protein PMID: 21478909
  43. Arf GTPases may be central components in WAVE signalling, acting directly, alongside Rac1. PMID: 21844371
  44. Molecular basis of phosphatidylinositol 4-phosphate and ARF1 GTPase recognition by the FAPP1 pleckstrin homology (PH) domain. PMID: 21454700
  45. Arf1 regulates PLA2G6-A activity together with Arf4; and gene silencing of Arf1 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway. PMID: 20881058
  46. These data provide novel insights into the role of Arf1 in the regulation of viral RNA replication and the production of infectious hepatitis C virus. PMID: 21068255
  47. Insight into the role of dynamics in the conformational switch of the small GTP-binding protein Arf1. PMID: 20861011
  48. Vascular endothelial growth factor receptor-2 activates ADP-ribosylation factor 1 to promote endothelial nitric-oxide synthase activation and nitric oxide release from endothelial cells PMID: 20529868
  49. Data suggest a novel model in which ARF1 recruits PKD2 to the TGN by binding to Pro275 in its C1b domain followed by anchoring of PKD2 in the TGN membranes via binding of its C1a domain to diacylglycerol. PMID: 20089835
  50. Data demonstrate a key role of Rab and Arf family small GTPases and intracellular trafficking in mTORC1 activation. PMID: 20457610

Show More

Hide All

Subcellular Location
Golgi apparatus. Cytoplasm, perinuclear region. Cell junction, synapse, synaptosome. Cell junction, synapse, postsynaptic density. Membrane; Lipid-anchor. Golgi apparatus, trans-Golgi network membrane; Lipid-anchor.
Protein Families
Small GTPase superfamily, Arf family
Database Links

HGNC: 652

OMIM: 103180

KEGG: hsa:375

STRING: 9606.ENSP00000272102

UniGene: Hs.286221

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*