Recombinant Human ADP-ribosylation factor 4 (ARF4)

Code CSB-RP009154h
Abbreviation Recombinant Human ARF2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ARF4
Uniprot No.
Research Area
Transport
Alternative Names
ADP ribosylation factor 2 ; ADP ribosylation factor 4; ADP-ribosylation factor 4; ARF2; ARF4; ARF4_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-180aa
Target Protein Sequence
MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.5kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Gene References into Functions
  1. In summary, the authors show here that hepatitis C virus infection is associated with an upregulation of ARF4, which promotes hepatitis C virus replication. Upon hepatitis C virus infection, CREB3 was redistributed to nucleus and activated ARF4 transcription. PMID: 28840565
  2. found ADP-ribosylation factor (ARF) 4 is one of the putative target genes of Mir-221, and the direct binding relationship was further confirmed by dual-luciferase reporter assay. PMID: 28057486
  3. Data suggest that, when compared to intestinal epithelial cells (IECs) from germ-free mice, IECs from mice with commensal bacteria exhibit increased expression of microRNA-21-5p; up-regulation of expression of microRNA-21-5p appears to increase IEC permeability and up-regulates ADP ribosylation factor 4 (Arf4/ARF4) in mouse and human cells. PMID: 28760826
  4. ARF1+ARF4 are required for integrity of recycling endosomes but are involved in distinct transport pathways: the pair regulates retrograde transport from endosomes to the TGN. PMID: 23783033
  5. A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity. PMID: 24185178
  6. a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle PMID: 22105072
  7. The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf4. PMID: 22185782
  8. sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration. PMID: 22004728
  9. Arf4 regulates PLA2G6-A activity together with Arf1; and gene silencing of Arf4 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway. PMID: 20881058
  10. ARF4 is a critical molecule that directly regulates cellular phospholipase D2 activity and this ARF4-mediated PLD2 activation stimulates AP-1-dependent transcription in the EGF-induced cellular response PMID: 12446727
  11. ARF4L occurred on the plasma membrane after binding to GTP and into endosomes while binding to GDP; the inactive form of ARF4L causes localization of transferrin receptors to the endosomes while the active form causes transport to the plasma membrane. PMID: 15049518
  12. ARF4 participates in the regulation of glioblastoma apoptosis through the inhibition of stress-mediated apoptotic signals PMID: 19041174

Show More

Hide All

Subcellular Location
Golgi apparatus. Membrane; Lipid-anchor.
Protein Families
Small GTPase superfamily, Arf family
Database Links

HGNC: 655

OMIM: 601177

KEGG: hsa:378

STRING: 9606.ENSP00000306010

UniGene: Hs.652183

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*