Recombinant Human Acetylserotonin O-methyltransferase(ASMT)


In Stock
Code CSB-EP002216HU
Product Type Recombinant Protein
Size EP: USD1263
Uniprot No. P46597
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
Research Area Cell Biology
Source E.coli
Gene Names ASMT
Protein Names Recommended name: Acetylserotonin O-methyltransferase EC= 2.1.1.4 Alternative name(s): Hydroxyindole O-methyltransferase Short name= HIOMT
Expression Region 1-345aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 45.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Isoform 1 catalyzes the transfer of a methyl group onto N-acetylserotonin, producing melatonin (N-acetyl-5-methoxytryptamine). Isoform 2 and isoform 3 lack enzyme activity.
Protein Families Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family
Tissue Specificity Expressed in the pineal gland (at protein level). In the retina, very low expression is found at the mRNA level (PubMed:7989373), and not at the protein level (PubMed:8574683).
Database Links

HGNC: 750

OMIM: 300015

KEGG: hsa:438

UniGene: Hs.522572

Related Products

ASMT Antibodies

ASMT Antibodies for Human

ASMT Antibodies for Homo sapiens (Human)

ASMT Proteins

ASMT Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.