Recombinant Human Acetylserotonin O-methyltransferase (ASMT)

In Stock
Code CSB-EP002216HU
Abbreviation Recombinant Human ASMT protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ASMT
Uniprot No.
Research Area
Cell Biology
Alternative Names
acetylserotonin methyltransferase (Y chromosome); acetylserotonin N-methyltransferase; Acetylserotonin O-methyltransferase; ASMT; ASMTY; HIOM_HUMAN; HIOMT; HIOMTY; Hydroxyindole O-methyltransferase; OTTHUMP00000022834; OTTHUMP00000022835; OTTHUMP00000022836
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-345aa
Target Protein Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene coding for the Human ASMT protein (1-345aa) is introduced into a plasmid vector, creating recombinant plasmid that is subsequently transformed into e.coli cells. e.coli cells capable of surviving in the presence of a specific antibiotic are selected and then cultured under conditions favorable for the expression of the gene of interest. A N-terminal 10xHis tag and C-terminal Myc tag is attached to the protein. Post-expression, the recombinant Human ASMT protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is applied to resolve the resulting recombinant Human ASMT protein, revealing a purity exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Isoform 1 catalyzes the transfer of a methyl group onto N-acetylserotonin, producing melatonin (N-acetyl-5-methoxytryptamine). Isoform 2 and isoform 3 lack enzyme activity.
Gene References into Functions
  1. Even when considering only high-grade glioma patients, a low ASMT:CYP1B1 value, which suggests decreased melatonin and enhanced aggressiveness, was strongly associated with poor survival. Overall, our data reveal the prognostic value of the melatonergic system of gliomas and provide insights into the therapeutic role of melatonin. PMID: 26510398
  2. two single nucleotide polymorphisms (rs4446909 and rs5989681)in the promoter of ASMT do not contribute to the pathogenesis of schizophrenia in Chinese-Han subjects PMID: 26154813
  3. results indicate that expression of sleep onset delay relates to melatonin pathway genes. PMID: 25059483
  4. These data suggest a relationship between decreased mRNA and protein expression levels of ASMT gene and cognitive impairment. PMID: 24881886
  5. Bipolar disorder-associated SNP influences sleep and circadian rhythms in bipolar patients in remission and controls. PMID: 24308489
  6. study presents the X-ray crystal structure of ASMT; analysis of nonsynonymous variants found that the majority of these mutations reduced or abolished ASMT activity; estimate the allelic frequency of ASMT deleterious mutations ranges from 0.66% in Europe to 2.97% in Asia PMID: 22775292
  7. results support the possible involvement of the ASMT gene in autism spectrum disorders PMID: 23995775
  8. ASMT might be a susceptibility gene for autism PMID: 23349736
  9. Rare and common variations in ASMT might play a role in bipolar disorder vulnerability. PMID: 22694957
  10. Data found a splice site mutation in ASMT (IVS5+2T>C) and one stop mutation in MTNR1A (Y170X) - detected exclusively in patients with ADHD - for which biochemical analyses indicated that they abolish the activity of ASMT and MTNR1A. PMID: 21615493
  11. The expression of HIOMT in epithelial cells of striated ducts in human submandibular glands. PMID: 21437622
  12. study of genetic variability of ASMT in a cohort of patients with intellectual disability (ID)and controls; identifed patients with deleterious ASMT mutations and decreased ASMT activity; however, study does not support ASMT as a causative gene for ID PMID: 21251267
  13. Results show the AA genotype and the GG genotype of ASMT were associated with lower risk for having recurrent depressive disorder. In turn, patients with depression were characterised by reduced mRNA expression for ASMT. PMID: 20433639
  14. The results of this study indicated that HIOMT immunohistochemistry may be useful for the diagnosis of PPTs and be a prognostic factor in pineal parenchymal cell tumors. PMID: 20418777
  15. Two polymorphisms located in the acetylserotonin methyltransferase (ASMT)promoter were more frequent in autism spectrum disorders (ASD); analyses revealed a highly significant decrease in ASMT activity and melatonin level in individuals with ASD. PMID: 17505466
  16. The data of this study does not support a correleation between asmt gene and autism. PMID: 17957233

Show More

Hide All

Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-independent O-methyltransferase family
Tissue Specificity
Expressed in the pineal gland (at protein level). In the retina, very low expression is found at the mRNA level, and not at the protein level.
Database Links

HGNC: 750

OMIM: 300015

KEGG: hsa:438

UniGene: Hs.522572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*