Recombinant Human Allograft inflammatory factor 1(AIF1)

Code CSB-EP001490HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P55008
Relevance Actin-binding protein that enhances mbrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Ionized calcium-binding adapter molecule 1;Protein G1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Research Area Neuroscience
Source E.coli
Gene Names AIF1
Expression Region 2-147aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 32.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Subcellular Location Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, phagocytic cup
Tissue Specificity Detected in T-lymphocytes and peripheral blood mononuclear cells.
Database Links

HGNC: 352

OMIM: 601833

KEGG: hsa:199

STRING: 9606.ENSP00000365227

UniGene: Hs.76364

Related Products

AIF1 Antibodies

AIF1 Antibodies for Human

AIF1 Antibodies for Homo sapiens (Human)

AIF1 Proteins

AIF1 Proteins for Homo sapiens (Human)

AIF1 ELISA Kit

AIF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.