Recombinant Human Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (MGAT4A), partial

In Stock
Code CSB-EP890937HU
Abbreviation Recombinant Human MGAT4A protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
93-535aa
Target Protein Sequence
LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human MGAT4A is expressed in E.coli and covers amino acid region 93-535, representing a partial length version of the protein. The product includes an N-terminal 6xHis tag for easier purification and detection. SDS-PAGE analysis confirms the protein reaches purity levels above 85%. This preparation is designed for research use only and appears to deliver consistent performance across different experimental setups.

MGAT4A represents a key glycosyltransferase that modifies N-glycans and plays an important role in creating complex-type oligosaccharides. The enzyme's activity affects N-glycan branching patterns, which may influence protein folding and cell-cell interactions. Studying MGAT4A could help researchers better understand glycosylation pathways and how they relate to cellular function and disease processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

Researchers can use this recombinant MGAT4A protein to explore the enzyme's basic biochemical properties - things like optimal pH, temperature stability, and what cofactors it needs to function. The N-terminal 6xHis tag makes purification straightforward and allows for protein immobilization during kinetic experiments. Scientists can measure Km and Vmax values across different substrate concentrations to get a sense of the enzyme's catalytic efficiency. The partial protein construct (93-535aa) likely retains the catalytic domain, which should make it useful for core enzymology work.

2. Antibody Development and Validation

This purified recombinant protein works well as an immunogen for creating polyclonal or monoclonal antibodies against human MGAT4A. The >85% purity appears sufficient for standard immunization protocols and antibody testing. The 6xHis tag simplifies purification and can be helpful in tag-based ELISA assays when screening and validating antibody specificity. Such antibodies would likely prove valuable for Western blotting, immunoprecipitation, and tracking protein location within cells.

3. Protein-Protein Interaction Studies

Scientists can immobilize the 6xHis-tagged MGAT4A on nickel-affinity matrices for pull-down assays aimed at finding potential binding partners or regulatory proteins. The recombinant protein may serve as bait in biochemical screens using cell lysates or purified protein collections. Co-immunoprecipitation experiments that take advantage of the His tag could help reveal protein complexes that involve MGAT4A in glycosylation networks. Even this partial construct might preserve important protein interaction domains needed for studying how the enzyme is regulated.

4. Substrate Specificity and Inhibitor Screening

This recombinant enzyme allows researchers to systematically test substrate preferences and identify specific glycoprotein targets for N-acetylglucosaminyltransferase activity. Having purified protein enables controlled in vitro assays for testing various potential substrates and optimizing reaction conditions. Scientists can use this protein to screen for potential inhibitors or compounds that modulate MGAT4A activity in drug discovery efforts. The standardized protein preparation should provide reproducible results when comparing different experimental conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Gene References into Functions
  1. GnT-IVa may contribute to the malignancy of choriocarcinoma by promoting cell adhesion, migration and invasion through glycosylation of integrin beta1 and LAMP-2. PMID: 28534963
  2. Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium. PMID: 26589799
  3. Findings suggest that GnT-IVa is involved in regulating invasion of choriocarcinoma through modifications of the oligosaccharide chains of beta1 integrin. PMID: 23169300
  4. upregulation of mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetyl-glucosaminyl-transferase is associated with metastatic colorectal carcinoma PMID: 15688387
  5. We investigated mRNA levels of glycosyltransferases, namely, N-acetylglucosaminyltransferase a (GnT)-IVa, and found that (GnT)-IVa expression was decreased in HLE-cells Epirubicin resistant. PMID: 17488527
  6. The results of this work suggest that in T2D subjects, high levels of glucose and triglycerides are accompanied by an increase on MGAT4A mRNA levels and WBC count; condition that suggests a pro-inflammatory state due to a chronic metabolic stress. PMID: 17953760
  7. GNT-IV genetic variation is not associated with gastric cancer. PMID: 19751437

Show More

Hide All

Subcellular Location
[Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A]: Golgi apparatus membrane; Single-pass type II membrane protein.; [Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form]: Secreted.
Protein Families
Glycosyltransferase 54 family
Tissue Specificity
Expressed in pancreas, spleen, thymus, prostate, small intestine, peripheral blood leukocytes and lymph node. Strongly overexpressed in choriocarcinoma cancer cell lines. Down-regulated in pancreatic cancer.
Database Links

HGNC: 7047

OMIM: 604623

KEGG: hsa:11320

STRING: 9606.ENSP00000264968

UniGene: Hs.177576

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*