Recombinant Human Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (MGAT4A), partial

In Stock
Code CSB-MP890937HU
Abbreviation Recombinant Human MGAT4A protein, partial
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
93-535aa
Target Protein Sequence
LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human MGAT4A comes from a mammalian cell system and covers amino acid region 93-535. The protein features dual tags—an N-terminal 10xHis-tag and a C-terminal Myc-tag—which help with purification and detection. SDS-PAGE analysis shows the protein maintains a purity level above 85%, making it suitable for research applications. This recombinant protein is intended for research use only and doesn't include the complete sequence.

MGAT4A appears to play an important role in N-glycan branching, a process that seems crucial for proper protein folding and function. The protein acts as a glycosyltransferase, adding N-acetylglucosamine to specific mannose residues on glycoproteins. This modification is likely vital for cellular processes like cell-cell communication and protein stability. That's why MGAT4A has become a protein of interest in studies examining glycosylation pathways and related disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant MGAT4A protein has a higher probability of correct folding due to the mammalian expression system, which can provide proper eukaryotic folding environments and potential post-translational modifications important for glycosyltransferase function. However, the protein is a partial length (93-535aa) and contains dual tags (N-terminal 10xHis and C-terminal Myc), which may affect its structural integrity. The C-terminal Myc tag is particularly concerning as it may interfere with the catalytic domain or protein folding. While mammalian expression systems generally support proper folding, the partial nature (missing N-terminal cytoplasmic/transmembrane domains) and dual tagging mean the protein's bioactivity cannot be guaranteed without experimental validation. The purity >85% indicates some impurities that could include misfolded species. Without enzymatic activity validation, the protein's functional status remains uncertain.

1. Glycosyltransferase Enzyme Characterization Studies

This recombinant MGAT4A can be used for enzymatic studies only if glycosyltransferase activity is experimentally verified. While the mammalian expression system supports proper folding, the partial sequence (lacking the N-terminal transmembrane domain) and dual tags may affect enzyme kinetics and substrate recognition. The C-terminal Myc tag might sterically hinder the active site or affect protein conformation. Before quantitative kinetic studies, validate activity using accepted substrates (e.g., oligosaccharide acceptors) and compare with full-length enzyme standards. The purity of>85% may require further purification for reliable kinetic measurements.

2. Protein-Protein Interaction Studies

The dual-tagged MGAT4A can be used in interaction studies, but detected partners may reflect tag-mediated artifacts rather than biological interactions. The partial sequence (93-535aa) represents mainly the catalytic domain and may lack regulatory regions important for native interactions. For valid results, validate folding first and include rigorous controls (e.g., tag-only proteins, catalytically inactive mutants). The mammalian expression system increases the likelihood of proper folding, but independent confirmation is still necessary.

3. Antibody Development and Validation

This recombinant MGAT4A can generate antibodies, but the dual tagging may result in antibodies that primarily recognize tags rather than MGAT4A-specific epitopes. The partial sequence (93-535aa) may not represent full conformational epitopes of the native protein. For specific antibodies, validate using full-length MGAT4A or confirm recognition of endogenous protein. The purity of>85% is acceptable but not optimal, as contaminants could induce non-specific antibodies.

4. Structural and Biophysical Analysis

The protein is unsuitable for high-resolution structural studies without tag removal and purity improvement. The dual tags introduce flexibility and heterogeneity that hinder crystallography or cryo-EM. The purity >85% is suboptimal for structural work (typically requiring >95%). Biophysical techniques can assess general folding, but for meaningful structural insights, remove tags, increase purity, and validate native conformation through activity assays. The mammalian expression system supports proper glycosylation but cannot overcome tag-induced structural artifacts.

Final Recommendation & Action Plan

To ensure reliable results, first validate the folding and bioactivity of the recombinant MGAT4A through enzymatic activity assays using appropriate sugar nucleotide donors and oligosaccharide acceptors, coupled with structural analysis (e.g., circular dichroism for secondary structure). Given the potential interference from dual tags, consider tag removal via proteolytic cleavage (if cleavage sites are present) and re-purify the tag-free protein for enzymatic and structural studies. For applications like antibody development, use the current protein but validate resulting antibodies against full-length MGAT4A. Always include appropriate controls in experiments, such as tag-free proteins or catalytically inactive mutants, to account for potential artifacts. The mammalian expression system provides advantages for proper folding, but independent validation remains essential for quantitative applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Gene References into Functions
  1. GnT-IVa may contribute to the malignancy of choriocarcinoma by promoting cell adhesion, migration and invasion through glycosylation of integrin beta1 and LAMP-2. PMID: 28534963
  2. Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium. PMID: 26589799
  3. Findings suggest that GnT-IVa is involved in regulating invasion of choriocarcinoma through modifications of the oligosaccharide chains of beta1 integrin. PMID: 23169300
  4. upregulation of mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetyl-glucosaminyl-transferase is associated with metastatic colorectal carcinoma PMID: 15688387
  5. We investigated mRNA levels of glycosyltransferases, namely, N-acetylglucosaminyltransferase a (GnT)-IVa, and found that (GnT)-IVa expression was decreased in HLE-cells Epirubicin resistant. PMID: 17488527
  6. The results of this work suggest that in T2D subjects, high levels of glucose and triglycerides are accompanied by an increase on MGAT4A mRNA levels and WBC count; condition that suggests a pro-inflammatory state due to a chronic metabolic stress. PMID: 17953760
  7. GNT-IV genetic variation is not associated with gastric cancer. PMID: 19751437

Show More

Hide All

Subcellular Location
[Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A]: Golgi apparatus membrane; Single-pass type II membrane protein.; [Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form]: Secreted.
Protein Families
Glycosyltransferase 54 family
Tissue Specificity
Expressed in pancreas, spleen, thymus, prostate, small intestine, peripheral blood leukocytes and lymph node. Strongly overexpressed in choriocarcinoma cancer cell lines. Down-regulated in pancreatic cancer.
Database Links

HGNC: 7047

OMIM: 604623

KEGG: hsa:11320

STRING: 9606.ENSP00000264968

UniGene: Hs.177576

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*