Recombinant Human Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A (MGAT4A), partial

In Stock
Code CSB-MP890937HU
Abbreviation Recombinant Human MGAT4A protein, partial
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
93-535aa
Target Protein Sequence
LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human MGAT4A comes from a mammalian cell system and covers amino acid region 93-535. The protein features dual tags—an N-terminal 10xHis-tag and a C-terminal Myc-tag—which help with purification and detection. SDS-PAGE analysis shows the protein maintains a purity level above 85%, making it suitable for research applications. This recombinant protein is intended for research use only and doesn't include the complete sequence.

MGAT4A appears to play an important role in N-glycan branching, a process that seems crucial for proper protein folding and function. The protein acts as a glycosyltransferase, adding N-acetylglucosamine to specific mannose residues on glycoproteins. This modification is likely vital for cellular processes like cell-cell communication and protein stability. That's why MGAT4A has become a protein of interest in studies examining glycosylation pathways and related disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Glycosyltransferase Enzyme Characterization Studies

Researchers can use this recombinant MGAT4A protein to investigate the enzymatic properties and substrate specificity of this N-acetylglucosaminyltransferase under controlled in vitro conditions. The dual His and Myc tags make protein purification and detection more straightforward, allowing scientists to study enzyme kinetics, optimal reaction conditions, and cofactor requirements. Since the protein comes from a mammalian expression system, it's more likely to have proper protein folding and post-translational modifications that may be critical for enzymatic function. Studies like these could help us understand the biochemical mechanisms behind N-glycan biosynthesis pathways.

2. Protein-Protein Interaction Studies

Both the N-terminal His tag and C-terminal Myc tag make this protein well-suited for pull-down assays and co-immunoprecipitation experiments. These approaches might help identify potential binding partners or regulatory proteins that interact with MGAT4A. The tags allow for immobilization on appropriate matrices and detection using tag-specific antibodies, which could lead to discovering protein complexes involved in glycosylation processes. Interaction studies like these may reveal regulatory mechanisms and pathway components that influence how MGAT4A functions in cellular glycan processing.

3. Antibody Development and Validation

This purified recombinant protein works well as an antigen for generating specific antibodies against human MGAT4A or for validating existing antibodies. The high purity level (>85%) and defined protein region (aa 93-535) offer a standardized target for immunization protocols or ELISA-based antibody screening. The dual tags also provide alternative detection methods to confirm antibody specificity and test for cross-reactivity.

4. Structural and Biophysical Analysis

Scientists can apply this recombinant MGAT4A protein in structural biology approaches like X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to understand the three-dimensional structure of this glycosyltransferase domain. The mammalian expression system should provide properly folded protein that's suitable for biophysical characterization techniques, including dynamic light scattering, thermal stability assays, and circular dichroism spectroscopy. Analysis like this might provide insights into the molecular architecture and conformational properties of this important glycan-processing enzyme.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
Gene References into Functions
  1. GnT-IVa may contribute to the malignancy of choriocarcinoma by promoting cell adhesion, migration and invasion through glycosylation of integrin beta1 and LAMP-2. PMID: 28534963
  2. Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium. PMID: 26589799
  3. Findings suggest that GnT-IVa is involved in regulating invasion of choriocarcinoma through modifications of the oligosaccharide chains of beta1 integrin. PMID: 23169300
  4. upregulation of mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetyl-glucosaminyl-transferase is associated with metastatic colorectal carcinoma PMID: 15688387
  5. We investigated mRNA levels of glycosyltransferases, namely, N-acetylglucosaminyltransferase a (GnT)-IVa, and found that (GnT)-IVa expression was decreased in HLE-cells Epirubicin resistant. PMID: 17488527
  6. The results of this work suggest that in T2D subjects, high levels of glucose and triglycerides are accompanied by an increase on MGAT4A mRNA levels and WBC count; condition that suggests a pro-inflammatory state due to a chronic metabolic stress. PMID: 17953760
  7. GNT-IV genetic variation is not associated with gastric cancer. PMID: 19751437

Show More

Hide All

Subcellular Location
[Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A]: Golgi apparatus membrane; Single-pass type II membrane protein.; [Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form]: Secreted.
Protein Families
Glycosyltransferase 54 family
Tissue Specificity
Expressed in pancreas, spleen, thymus, prostate, small intestine, peripheral blood leukocytes and lymph node. Strongly overexpressed in choriocarcinoma cancer cell lines. Down-regulated in pancreatic cancer.
Database Links

HGNC: 7047

OMIM: 604623

KEGG: hsa:11320

STRING: 9606.ENSP00000264968

UniGene: Hs.177576

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*