Name: Recombinant Human 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 (FUT6), partial
Brand: CUSABIO
SKU: 009080HU1

Product Details

Purity

>85% (SDS-PAGE)

Target Names

FUT6

Uniprot No.

P51993

Alternative Names

FUT6; FCT3A; 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6; Fucosyltransferase 6; Fucosyltransferase VI; Fuc-TVI; FucT-VI; Galactoside 3-L-fucosyltransferase

Species

Homo sapiens (Human)

Protein Length

partial, Lumenal domain

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Please provide the following information for CSB-EP009080HU1:
1. Sequence
2. Tag type
3. Tag position
4. Sizes and formats
5. What is the yeast strain used for expression?

Thanks for your inquiry.
Recombinant Human Alpha-(1,3)-fucosyltransferase(FUT6), partial
CSB-EP009080HU1 >> E.coli
You can view the full information of sequence and Tag on this page.
The yeast strain used for expression is pichia pastoris, the common strains are GS115, X33, KM71, SMD1168, PINK, etc.

Regarding your Protein CSB-YP009080HU1, could you please provide some information?
I was interested in a functional protein, which I know you do not QC for, but I was wondering if I could get some information on the vector/plasmid construct (map), so that I might compare it to literature/research papers to try and determine if it may have a chance of being enzymatically active. I believe I am interested in the Yeast-protein.
Lastly, did you guys look over any research papers/articles before offering this protein? Did you incorporate any of their sequencing or processes into this protein in order to optimize it?

Thanks for your inquiry.
Recombinant Human Alpha-(1,3)-fucosyltransferase(FUT6)
CSB-CF009080HU
Expression Region:1-359aa; Full length.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

Recombinant Human Alpha-(1,3)-fucosyltransferase(FUT6), partial
CSB-YP009080HU1 >> Yeast
Expression Region:35-359aa; Partial, provide the Lumenal domain
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 6xHis-tagged.
Sequence:

RVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT

The yeast strain used for expression is pichia pastoris, the common strains are GS115, X33, KM71, SMD1168, PINK, etc.
Yes, we have never validated the function of this protein, so there isn't any QC for your reference.
We will conduct codon optimization for the corresponding expression system according to your order information,
we can provide the frequently-used Yeast vector/plasmid construct (map) for your reference if you need.

Target Background

Function

Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the N-acetyl glucosamine (GlcNAc) of a distal alpha2,3 sialylated lactosamine unit of a glycoprotein- or a glycolipid-linked sialopolylactosamines chain or of a distal or internal lactosamine unit of a neutral glycoprotein- or a glycolipid-linked polylactosamines chain through an alpha-1,3 glycosidic linkage and participates in surface expression of the sialyl Lewis X (sLe(x)), Lewis X (Le(x)) and non sialylated VIM2 determinants. Moreover transfers fucose to H-type 2 (Fucalpha1-2Galbeta1-4GlcNAc) chain acceptor substrates and participates in difucosylated sialyl Lewis x determinants. Also fucosylates a polylactosamine substrate having a 6 sulfate modification at the GlcNAc moiety and gives rise to sialyl and non-sialyl 6-sulfo lewis X. Does not have activity towards type 1 ((Galbeta1-3GlcNAc)) and H-type 1 chain (Fucalpha1-2Galbeta1-3GlcNAc) acceptors substrates.; Does not have alpha(1,3)-fucosyltransferase activity.

Gene References into Functions

meta-analysis identified new variants, rs3760775 (P = 1.2 x 10-23) and rs78060698 (P = 8.3 x 10-17) in FUT6 to be associated with circulating B12 concentrations. PMID: 28334792
ur results strongly showed that the low expression of FUT6 regulated by miR-106b contributed to cell migration, invasion, and proliferation in human breast cancer. PMID: 27519168
There were significant differences between the type 2 diabetes mellitus patients and controls in the risk allele distributions of rs3792267 (CAPN10) (P = 0.002), rs1501299 (APM1) (P = 0.017), and rs3760776 (FUT6) (P = 0.031). PMID: 27374856
The T allele of rs3760776 might repress the transcription of the FUT6 gene. PMID: 25962326
In normal colon samples a significant relationship between sLe(x) expression and the ratio between FUT6/B4GALNT2 activities exists, demonstrating for the first time a role for B4GALNT2 in sLe(x) inhibition in vivo PMID: 24953560
these results suggest that FUT6 plays an important role in hepatocellular carcinoma growth by regulating the PI3K/Akt signaling pathway. PMID: 22155250
endo-beta-galactosidase-sensitive and mAb FH6-reactive carbohydrate chains are generated under the control of expression levels of FUT6 and involved in the adhesion of colon carcinoma cells to liver sections. PMID: 12670495
5'UT-exons A or C have higher expression of FUT8 transcripts and higher alpha6-fucosyltransferase activity PMID: 14514715
IL-1 beta-induced sLeX expression on HuH-7 cells was suppressed by transfection of gene-specific small interference RNAs against FUT VI and ST3Gal IV but not against FUT IV and ST3Gal III. PMID: 17054948
two defined regions in the 5'-flanking region of the FUT VI transcription start site are critical for FUT VI transcription in HepG2 cells PMID: 18274891

Hide All

Subcellular Location

Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Golgi apparatus. Secreted. Note=Membrane-bound form in trans cisternae of Golgi.

Protein Families

Glycosyltransferase 10 family

Tissue Specificity

Kidney, liver, colon, small intestine, bladder, uterus and salivary gland.

Database Links

HGNC: 4017

OMIM: 136836

KEGG: hsa:2528

STRING: 9606.ENSP00000286955

UniGene: Hs.631846

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP009080HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP009080HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP009080HU1-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP009080HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP009080HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase FUT6 (FUT6), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage