Recombinant Human Amyloid-beta A4 precursor protein-binding family A member 1 (APBA1), partial

Code CSB-YP161060HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP161060HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP161060HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP161060HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP161060HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
APBA1
Uniprot No.
Alternative Names
Amyloid-beta A4 precursor protein-binding family A member 1; Adapter protein X11alpha; Neuron-specific X11 protein; Neuronal Munc18-1-interacting protein 1; Mint-1; APBA1 MINT1 X11
Species
Homo sapiens (Human)
Expression Region
457-643
Target Protein Sequence
DGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYND
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the amyloid-beta precursor protein (APP) and hence formation of APP-beta. Component of the LIN-10-LIN-2-LIN-7 complex, which associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules.
Gene References into Functions
  1. Mint1 causes amyloid precursor protein accumulation in the trans-Golgi network. PMID: 26865271
  2. Mints are necessary for activity-induced APP and PS1 trafficking and provide insight into the cellular fate of APP in endocytic pathways essential for Abeta production. PMID: 24742670
  3. Mint1 826 bridges APP to the small GTPase PMID: 23737971
  4. an autoinhibitory mechanism in Mint1 is important for regulating APP processing and may provide novel therapies for Alzheimer's disease PMID: 22355143
  5. Transcriptional co-activators Taz and Yap mediate signaling via the amyloid beta protein precursor paralogues APLP1 and APLP2 through interactions with Mint1 and Mint3. PMID: 21178287
  6. Study identified the conserved binding site for the peptide on the CASK calmodulin kinase domain. A related EPIWVMRQ peptide from Mint1 was also discovered to be sufficient for binding. PMID: 21763699
  7. Our findings show a new function for X11alpha that may impact on Alzheimer's disease pathogenesis. PMID: 20531236
  8. Methylation of MINT1 was significantly more prevalent in UC-CRC cases compared with controls. PMID: 20160714
  9. ApoEr2 regulates cell movement, and both X11alpha and Reelin enhance this effect. PMID: 19720620
  10. A novel consensus sequence for interaction with the PDZ-1 and PDZ-2 domains of amyloid precursor protein (APP)-interacting proteins Mint1, Mint2, and Mint3 is reported, with multiple novel interactors for these proteins. PMID: 20016085
  11. Munc18a acts through direct and indirect interactions with X11 proteins and powerfully regulates APP metabolism and Abeta secretion. PMID: 12016213
  12. Coexpression of X11alpha with amyloid protein precursor retarded its maturation, prolonged its half-life, and inhibited amyloid protein precursor, Abeta40, and Abeta42 secretion. PMID: 12849748
  13. human X11alpha inhibits Abeta production and deposition in vivo in the brain in transgenic mice harboring a familial Alzheimer's disease mutant APP that produces increased levels of Abeta. PMID: 12970358
  14. Involvement of X11L in the phosphorylation of APP family proteins in cellular stress and suggest that X11L protein may be . PMID: 14970211
  15. X11alpha and X11beta have roles in beta-amyloid precursor protein processing PMID: 15699037
  16. Mediates exocytosis and decreases beta-amyloid peptide formation in Alzheimer disease. PMID: 16413130
  17. Data show that neuronal munc18-1-interacting protein 1 is an inclusion body component in neuronal intranuclear inclusion disease identified by anti-SUMO-1-immunocapture. PMID: 18836734

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, perinuclear region. Nucleus. Note=Only about 5% of the protein is located in the nucleus.; [Isoform 2]: Golgi apparatus.
Tissue Specificity
Brain and spinal cord. Isoform 2 is expressed in testis and brain, but not detected in lung, liver or spleen.
Database Links

HGNC: 578

OMIM: 602414

KEGG: hsa:320

STRING: 9606.ENSP00000265381

UniGene: Hs.171939

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×