Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ANXA4

Uniprot No.

P09525

Research Area

Cardiovascular

Alternative Names

35 beta calcimedin; 35-beta calcimedin; AIV; Annexin 4; Annexin A4; Annexin IV (placental anticoagulant protein II); Annexin IV; Annexin IV placental anticoagulant protein II; Annexin-4; AnnexinA4; AnnexinIV; ANX 4; ANX A4; ANX4; ANXA 4; ANXA4; ANXA4 protein; ANXA4_HUMAN; Carbohydrate binding protein P33/P41; Carbohydrate-binding protein p33/p41; Chromobindin 4; Chromobindin-4; Chromobindin4; DKFZp686H02120; Endonexin I; EndonexinI; Lipocortin IV; LipocortinIV; MGC75105; OTTHUMP00000160052; OTTHUMP00000202207; P32.5; P33/41; PAP II; PAP-II; PAPII; PIG 28; PIG28; Placental anticoagulant protein II; PP4 X; PP4-X; PP4X; Proliferation inducing gene 28; Proliferation inducing protein 28; Protein II; Xanx-4; ZAP 36; ZAP36

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-319aa

Target Protein Sequence

ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

55.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 2-319 constitute the expression domain of recombinant Human ANXA4. This ANXA4 protein is theoretically predicted to have a molecular weight of 55.8 kDa. This ANXA4 recombinant protein is manufactured in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of ANXA4, making it easier to detect and purify the ANXA4 recombinant protein in the later stages of expression and purification.

Annexin A4 (ANXA4) is a protein that has recently attracted a lot of attention in research, especially in the study of cancer. It plays a crucial role in tumor invasion and metastasis. Researchers have found that when ANXA4 is excessively expressed, it is closely linked to the development and worsening of certain cancers, such as breast cancer and lung cancer. This makes ANXA4 a potential marker for cancer and a target for treatment, offering new perspectives for detecting and treating cancer early. Additionally, ANXA4 is connected to the regulation of inflammation and the immune system. Studies show its involvement in controlling cell apoptosis, inflammatory responses, and immune regulation, providing important insights into understanding diseases related to the immune system and inflammation.

Target Background

Function

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Gene References into Functions

ANXA4 expression was increased at both the mRNA and protein level in the drugresistant ovarian cancer cells, and ANXA4 contained a Lewis(y) structure. ANXA4 overexpression can abnormally activate signaling pathways and regulate the expression of a numbers of factors, forming a positive feedback loop to induce the chemoresistance of ovarian cancer cells. PMID: 30066907
Annexin A4 binds to artificial membranes and generates curvature force initiated from free edges, whereas annexin A6 induces constriction force. PMID: 29158488
Taken together, these data indicate that up-regulation of ANXA4 leads to activation of the NF-kappaB pathway and its target genes in a feedback regulatory mechanism via the p65 subunit, resulting in tumor growth in GBC. PMID: 27491820
Upregulation and nuclear translocation of ANXA4 have been observed in the progression of colorectal cancer and ovarian serous carcinoma. Knockdown of ANXA4 attenuated migration in ovarian cancer and breast cancer cells. In contrast, knockdown of ANXA4 increased susceptibility to platinum in ovarian cancer and malignant mesothelioma cells. Review. PMID: 27100483
Study identifies ANXA4 and FLNA as up-regulated in buccal squamous cell carcinoma arising from oral submucous fibrosis. PMID: 27485544
High ANXA4 expression is associated with metastasis of hepatocellular carcinoma. PMID: 26779633
annexin A4 can be regarded as an important molecular marker in triple-negative breast cancer prognosis. PMID: 27650619
role of annexin A4 in cancer PMID: 26048190
Data shows that CYTB and ANXA4 overexpression may be involved in carcinogenesis and histopathological differentiation of ovarian clear cell carcinoma and suggest they may serve as a potential diagnostic biomarkers. PMID: 25633807
These findings indicate that the calcium-binding site in the ANXA4 repeat induces chemoresistance to the platinum-based drug by elevating the intracellular chloride concentration. PMID: 25277200
Fhit delocalizes annexin A4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel. PMID: 24223161
enhanced expression of Anx A4 confers platinum resistance by promoting efflux of platinum drugs via ATP7A. PMID: 24150977
This study showed that overexpression and nuclear localization of annexin A4 are related to chemoresistance and poor survival in patients with serous papillary ovarian carcinomas. PMID: 23290009
suggest that ANXA4 triggers a signaling cascade, leading to increased epithelial cell proliferation, ultimately promoting carcinogenesis PMID: 22970268
Lower expression of annexin A4 during window of implantation in infertile patients with endometriosis might be associated with the decrease of endometrial receptivity. PMID: 22883517
Eight ANXA4 polymorphisms are significantly associated with the risk of aspirin-exacerbated respiratory disease. PMID: 22847161
that H3K4 tri- and dimethylation play an important role and that JARID1A is the histone-demethylating enzyme responsible for removal of this mark PMID: 21348943
In an Alzheimer model, transgenic mice overexpressing mutant human amyloid precursor protein (APP) show a significant increase of annexin A5 in the brain cortex but not in other organs, including liver, kidney, lung, and intestine. PMID: 20648654
Annexin A4 differentially modulates the NF-kappaB signaling pathway, depending on its interactions with p50 and the intracellular Ca(2+) ion level. PMID: 20237821
The overexpression of Annexin IV may be an ovarian CCC-specific molecular marker. PMID: 19955935
annexin IV plays an important role in the morphological diversification and dissemination of the clear cell renal cell carcinoma PMID: 15145526
This work provides mechanistic insight into how annexin A4 may regulate plasma membrane protein function. PMID: 16687573
ANXA4 transcription and translation are regulated by progesterone. ANXA4 may be important in regulating ion and water transport across the endometrial epithelium. PMID: 16954445
There were no significant differences in plasma annexin IV levels between women with and without antiphospholipid antibodies PMID: 17363042
Enhanced expression of Annexin A4 is associated with clear cell carcinoma of the ovary PMID: 19598262

Hide All

Subcellular Location

Zymogen granule membrane; Peripheral membrane protein.

Protein Families

Annexin family

Database Links

HGNC: 542

OMIM: 106491

KEGG: hsa:307

STRING: 9606.ENSP00000377833

UniGene: Hs.422986

Code	CSB-EP001845HU
Abbreviation	Recombinant Human ANXA4 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Annexin A4 (ANXA4)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage