Recombinant Human Arylamine N-acetyltransferase 1 (NAT1)

In Stock
Code CSB-EP015464HU
Abbreviation Recombinant Human NAT1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
NAT1
Uniprot No.
Research Area
Cell Biology
Alternative Names
Arylamide acetylase 1;Monomorphic arylamine N-acetyltransferase;MNAT;N-acetyltransferase type 1;NAT-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-290aa
Target Protein Sequence
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Gene References into Functions
  1. Data showed that NAT1, NAT2, and ESR1 expression were increased in primary breast tumor tissue and that NAT1 expression was much higher than NAT2. NAT1 and ESR1 expression were strongly associated, whereas NAT2 and ESR1 expression were not. Although NAT1 and NAT2 expression were associated, the magnitude was moderate. PMID: 29901116
  2. the results suggested that there was no association between NAT1*10 allele and bladder cancer risk (meta-analysis). PMID: 28604993
  3. identified a novel endogenous role for human NAT1 that might explain some of its effects in cancer cell growth and survival PMID: 27865712
  4. N-acetyltransferase polymorphisms are associated with risk of lymphoma subtypes. PMID: 25689677
  5. The association of colorectal adenomas with the rs6983267 variant at 8q24 was considered as 'highly credible', the 'less credible' associations were identified with a further four variants of four independent genes: MTHFR c.677C>T p.A222V(rs1801133), TP53 c.215C>G p.R72P (rs1042522), NQO1 c.559C>T p.P187S (rs1800566), and NAT1 alleles imputed as fast acetylator genotypes. [meta-analysis] PMID: 26451011
  6. The rs1799931(G>A) genotype was detected in the control population but not in the T2DM population. The wild type (G) allele frequency was higher in T2DM than controls. The mutant allele (A) in rs1799931(G>A) had a protective effect for T2DM. PMID: 26409796
  7. NAT1 genotype affects thioguanine nucleotide levels in patients treated with thiopurines and aminosalicylates and could therefore influence the toxicity and efficacy of these drugs. PMID: 25834322
  8. NAT1 genetic polymorphisms were found to be a risk factor for smokers in the Black population of South Africa with esophageal squamous cell carcinoma. PMID: 25886288
  9. NAT1 has a role in the metabolic pathway of nicotine/cotinine and/or their metabolites. PMID: 25156213
  10. We report that miR-1290 directly targets the NAT1 3'-UTR and that NAT1 protein expression is correlated with improved OS of breast cancer patients. PMID: 25528056
  11. Arylamine N-acetyltransferase polymorphisms in Han Chinese patients with ankylosing spondylitis and their correlation to the adverse drug reactions to sulfasalazine PMID: 25413361
  12. Candidate gene NAT1 were elevated in male breast cancer biopsies compared to those from female patients without regard to Estrogen Receptors status. PMID: 24656773
  13. Data suggest that NAT1/NAT2 participate in biotransformation of many aromatic/heterocyclic amines; molecular models have been developed regarding acetylation mechanism, active site structure, and substrate/inhibitor-binding specificity. [REVIEW] PMID: 23517104
  14. Epidemiological studies suggest that the NAT1 and NAT2 acetylation polymorphisms modify the risk of developing cancers of the urinary bladder, colorectal, breast, head and neck, and lung PMID: 23420430
  15. the present study provides evidence for the role of NAT1 and NAT2 variations in NSCLP, and indicates that interactions between the NAT1 and NAT2 genes may be important in susceptibility to NSCLP. PMID: 23660777
  16. NAT1 rapid acetylation alone as well as combination of NAT1 rapid-NAT2 slow acetylation did not modulate the risk of oral precancer and cancer in an Indian patient population. PMID: 23168701
  17. Only ADP and ATP are suitable substrates for human AAC1. PMID: 23173940
  18. Complementation studies revealed that the N-terminal domain of L9 is necessary and sufficient to improve the fitness of some Der mutants, suggesting that this domain may help stabilize compromised ribosomes that accumulate when Der is defective. PMID: 23772068
  19. This meta-analysis suggests that there was no association between the NAT1*10 allele and bladder cancer risk. PMID: 23569127
  20. Upregulation of NAT1 is associated with estrogen receptor alpha-positive breast cancer. PMID: 23183268
  21. Smoking, variation in N-acetyltransferase 1 (NAT1) and 2 (NAT2), and risk of non-Hodgkin lymphoma. PMID: 23160945
  22. individuals with NAT2 genotype have an elevated risk of colorectal cancer; however, no evidence was found for association between NAT1 and 2 rapid genotype and colorectal adenoma risk PMID: 22905173
  23. NAT1 is a possible prognostic biomarker for male breast cancer. PMID: 22333393
  24. meta-analysis wasn't able to detect a significant association between polymorphisms in NAT1 and predisposition to colorectal carcinoma PMID: 22327651
  25. Data suggest that the 5'-UTRs of arylamine N-acetyltransferase 1 (NAT1) are differentially regulated. PMID: 21837760
  26. NAT1 14B-catalyzed acetylation phenotype is substrate-dependent; NAT1 14B exhibits higher N- and O-acetylation catalytic efficiency. PMID: 22010219
  27. the activities of the xenobiotic metabolizing phase II enzyme N-acetyltransferase 1 (NAT1) were higher in the late passages compared to the early passages PMID: 22686306
  28. NAT1 is transcribed from a major promoter, NATb, and an alternative promoter, NATa, resulting in messenger RNAs (mRNAs) with distinct 5'-untranslated regions (UTRs). PMID: 22114069
  29. NAT1 affects cell growth and morphology PMID: 21347396
  30. We observe a signature of balancing selection maintaining variation in the 3'-UTR of NAT1, suggesting that these variants may play a functional role. PMID: 21995608
  31. NAT1 *10 and *11 significantly increase NAT1 protein level/enzyme activity, enabling the classification of carriers into reference and rapid acetylators PMID: 21878835
  32. effects of polymorphisms within NAT1 coding region and 3'-UTR and associated haplotypes on catalytic activity and mRNA and protein levels; findings provide support for reported associations of 1088T>A and 1095C>A polymorphisms with birth defects PMID: 21290563
  33. There is a lack of association of the N-acetyltransferase NAT1*10 allele with prostate cancer incidence, grade, or stage among smokers in Finland. PMID: 20931357
  34. Only NAT1 showed a significant lower DNA methylation rate in the control group than in the tamoxifen-resistant breast cancer group, and no significant difference in methylation was found in COMT, CYP1A1, CYP2D6, and SULT1A1 genes. PMID: 20628863
  35. NAT1 and NAT2 gene combinations may influence the risk of developing head and neck cancer. PMID: 19898993
  36. There was no evidence of an increased risk associated with preference for well-done meat, intake of well-done meat, and NAT1 or NAT2 genotypes (jointly or separately). PMID: 20570911
  37. HSF1 is an important transcription factor for induction of NAT1 in human cells and is required for androgen activation of the NAT1 promoter. PMID: 20176657
  38. results suggest that the relationship between non-Hodgkin lymphoma and smoking status may be modified by common genetic variation in NAT1. PMID: 19809881
  39. the results of this study demonstrate that NAT1 activity may be important in breast cancer growth and metastasis. PMID: 20100460
  40. Slow metabolic phenotype of NAT1 combined with slow or intermediate NAT2 phenotype increases risk for occupational dermatitis PMID: 19834256
  41. NAT1 genotype acts as a modifier of diisothionate exposure-associated asthma risk PMID: 11927838
  42. paclitaxel is an uncompetitive inhibitor to arylamine N-acetyltransferase (NAT) enzyme PMID: 11955676
  43. paclitaxel affected human leukemia HL-60 cells arylamine N-acetyltransferase (NAT) activity and DNA-2-aminofluorene adduct formation. PMID: 11955677
  44. NAT1 polymorphisms may be correlated with an increased risk of larynx cancer PMID: 12037388
  45. susceptibility gene for multifactorial adverse effects and xenobiotic-related diseases (review) PMID: 12052143
  46. NAT1 polymorphism (NAT1*10) indicates increased susceptibility to prostate cancer PMID: 12355549
  47. NAT1 * 10 has increased risk of sporadic colorectal adenocarcinoma and significantly related to the later stage tumors, is not significantly related to the tumor location PMID: 12485520
  48. Single nucleotide polymorphisms of NAT1 and NAT2, and acetylation haplotype were not associated with increased risk for Parkinson disease PMID: 12682333
  49. It is unlikely that the NAT1*10 or NAT2 rapid/intermediate genotypes are related to stomach cancer risk. PMID: 12692115
  50. Oxidative stress and cellular redox status may regulate NAT1 activity and have important consequences with regard to drug biotransformation and cancer risk. PMID: 12832400

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Arylamine N-acetyltransferase family
Database Links

HGNC: 7645

OMIM: 108345

KEGG: hsa:9

STRING: 9606.ENSP00000443194

UniGene: Hs.2

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*