Recombinant Human Astrocytic phosphoprotein PEA-15 (PEA15)

Code CSB-EP621865HU
Abbreviation Recombinant Human PEA15 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PEA15
Uniprot No.
Research Area
Cell Biology
Alternative Names
15 kDa phosphoprotein enriched in astrocytes; Astrocytic phosphoprotein PEA 15; Astrocytic phosphoprotein PEA-15; Astrocytic phosphoprotein PEA15; HMAT 1; HMAT1; Homolog of mouse MAT 1 oncogene; Homolog of mouse MAT1 oncogene; HUMMAT 1H; HUMMAT1H; MAT 1; MAT 1H; MAT1; MAT1H; PEA 15; Pea15; PEA15 protein; PEA15_HUMAN; PED; Phosphoprotein enriched in astrocytes 15; Phosphoprotein enriched in astrocytes 15kD; Phosphoprotein enriched in diabetes
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-130aa
Target Protein Sequence
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm. Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.
Gene References into Functions
  1. Data suggest that PED has a prominent role in HCC biology. It acts particularly on promoting cell migration and confers resistance to sorafenib treatment. PMID: 29072691
  2. PP4 regulates breast cancer cell survival and identifies a novel PP4c-PEA15 signalling axis in the control of breast cancer cell survival. PMID: 27317964
  3. PEA15 expression was not significantly correlated with ovarian cancer antineoplastic drug resistance. PMID: 27669502
  4. Data suggest the role of the phospholipase C epsilon-Protein kinase D-PEA15 protein-ribosomal S6 kinase-IkappaB-NF-kappa B pathway in facilitating inflammation and inflammation-associated carcinogenesis in the colon. PMID: 27053111
  5. Integrin alpha5beta1 and p53 convergent pathways in the control of anti-apoptotic proteins PEA-15 and survivin in high-grade glioma. PMID: 26470725
  6. High PED expression is associated with esophageal carcinoma. PMID: 25775393
  7. The nuclear translocation of SApErk1/ 2 apart from PEA-15 as an important mechanism to reverse senescence phenotype. PMID: 25725291
  8. Latent HCMV infection of CD34 + cells protects cells from FAS-mediated apoptosis through the cellular IL-10/PEA-15 pathway. PMID: 25957098
  9. New therapeutic targets based around PEA-15 and its associated interactions are now being uncovered and could provide novel avenues for treatment strategies in multiple diseases. PMID: 24657708
  10. PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism PMID: 25489735
  11. Omi/HtrA2 overexpression promotes hepatocellular carcinoma cell apoptosis and the ped/pea-15 expression level causes this difference of the Omi/HtrA2 pro-apoptotic marker in the various hepatocellular carcinoma cell lines PMID: 25484138
  12. Results suggest that neurochemical adaptations of brain FADD, as well as its interaction with PEA-15, could play a major role to counteract the known activation of the mitochondrial apoptotic pathway in major depression PMID: 25075716
  13. Data show that phosphoprotein enriched in astrocytes of 15 kDa (PEA-15) influences dephosphorylation of epidermal growth factor receptor (EGFR) via extracellular signal-regulated kinases ERK1/2 sequestration in the cytoplasm. PMID: 25796184
  14. Tumor suppressor PEA15 is a regulator of genome integrity and is an integral component of the DNA damage response pathway. PMID: 24710276
  15. Up-regulated chaperone-mediated autophagy activity characteristic of most types of cancer cell enhances oncogenesis by shifting the balance of PED function toward tumor promotion. PMID: 24477641
  16. Our findings highlight the importance of pPEA-15 as a promising target for improving the efficacy of paclitaxel-based therapy in ovarian cancer. PMID: 23543364
  17. PEA-15 binding protects ERK2 from dephosphorylation, thus setting the stage for immediate ERK activity upon its release from the PEA-15 inhibitory complex PMID: 23575685
  18. study demonstrates that the PEA-15 protein decreases proliferation, clonogenicity, and invasiveness, but increases resistance to apoptosis in colorectal carcinoma cells PMID: 23481023
  19. The article hypothesizes that only unphosphorylated PEA-15 can act as a tumor-suppressor and that phosphorylation alters the interaction with binding partners to promote tumor development. PMID: 22694972
  20. NMR chemical shift perturbation and backbone dynamic studies at the fast ps-ns timescale of PED/PEA-15, in its free form and in the complex with ERK2. PMID: 22820249
  21. The 67 kD laminin receptor is a novel PED/PEA-15 interacting protein. PED/PEA-15 overexpression increases 67LR-mediated cell adhesion and migration to laminin and extracellular matrix invasion. PMID: 21895963
  22. the solution death effector domain (DED) structure of the PED/PEA-15 protein, a representative member of DED subfamily, using traditional NMR restraints with the addition of residual dipolar coupling restraints was refined. PMID: 22732408
  23. PEA15 impairs cell migration and correlates with clinical features predicting good prognosis in neuroblastoma PMID: 22213050
  24. Data show that knockdown of PEA-15 expression resulted in reversal of selumetinib-sensitive cells to resistant cells, implying that PEA-15 contributes to selumetinib sensitivity. PMID: 22144664
  25. Vitamin D3 signalling in the brain enhances the function of phosphoprotein enriched in astrocytes--15 kD (PEA-15) PMID: 19382910
  26. The protective effect of melatonin is likely mediated, in part, by inhibition of peroxynitrate-mediated nitrosative stress, which in turn relieves imbalance of mitochondrial HtrA2-PED signaling and endothelial cell death. PMID: 21198825
  27. There was no significant difference in the frequency of three marker haplotype in the PEA15 gene in patient with schizophrenia. PMID: 20537721
  28. The expressions of PED/PEA-15 and XIAP are elevated in hepatocellular carcinoma as compared with adjacent tissues and normal tissues. PMID: 20979872
  29. PED/PEA-15 modulates Coxsackievirus-adenovirus receptor expression and adenoviral entry, by sequestering ERK1/2. PMID: 20406097
  30. provide molecular basis of the PED/PEA-15 functional interactions and detailed surface for the design and development of PED/PEA-15 binders PMID: 20825483
  31. Data show that PED and Rac1 interact and that this interaction modulates cell migration/invasion processes in cancer cells through ERK1/2 pathway. PMID: 20648624
  32. The results show that HNF-4alpha serves as a scaffold protein for histone deacetylase activities, thereby inhibiting liver expression of genes including PED. PMID: 20396999
  33. PEA-15 promotes autophagy in glioma cells in a JNK-dependent manner PMID: 20452983
  34. Data show that PEA-15 prevents ERK1/2 localization to the plasma membrane, thereby inhibiting ERK1/2-dependent threonine phosphorylation of FRS2alpha to promote activation of the ERK1/2 MAP kinase pathway. PMID: 20032303
  35. Results suggest that PEA-15 expression is likely to be associated with the tumorigenesis of alignant pleural mesothelioma. PMID: 19771552
  36. role of mitogen-activated protein kinase family members in anti-apoptotic function PMID: 11790785
  37. role in modulating tumor necrosis factor-related apoptosis-inducing ligand-induced death-inducing signaling complex PMID: 11976344
  38. interaction with p90 ribosomal S6 kinase isoenzyme regulates its activity PMID: 12796492
  39. phosphorylation by Akt regulates the antiapoptotic function of PED/PEA-15 at least in part by controlling the stability of PED/PEA-15 PMID: 12808093
  40. apoptosis following Omi/HtrA2 mitochondrial release is mediated by reduction in ped/pea-15 cellular levels PMID: 15328349
  41. PEA-15 is inhibited by adenovirus E1A and has a role in ERK nuclear export and Ras-induced senescence PMID: 15331596
  42. The mechanism controlling PEA-15 binding to ERK/MAPK or FADD, and its subsequent role in cell proliferation and apoptosis is reported. PMID: 15916534
  43. Raised expression of the antiapoptotic protein pea-15 increases susceptibility to chemically induced skin tumor development PMID: 16044159
  44. Human breast cancer cells express high levels of PED and that AKT activity regulates PED protein levels. AKT-dependent increase of PED expression levels represents a key molecular mechanism for chemoresistance in breast cancer. PMID: 16061647
  45. cytoplasmic sequestration of the activated form of ERK by PEA15 enables the action of E1A in ovarian neoplasms PMID: 16170361
  46. Akt overactivation prevents the nuclear translocation of ERK1/2 and the AngII-induced proliferation through interaction with and stabilization of endogenous PEA-15. PMID: 16822839
  47. These data reveal a new function for PEA-15 in the inhibitory control of astrocyte motility through a PKC delta-dependent pathway involving the constitutive expression of a catalytic fragment of PKC delta. PMID: 16987961
  48. PEA15 overexpression represents a common defect in first degree relatives of patients with type 2 diabetes and is correlated with reduced insulin sensitivity in these individuals. PMID: 17021921
  49. TPA increases PED/PEA-15 expression at the post-translational level by inducing phosphorylation at serine 116 and preventing ubiquitinylation and proteosomal degradation PMID: 17227770
  50. In addition to sequestering protein kinases ERK1/2 in the cytoplasm, PEA-15 has the potential to modulate the activity of ERK2 in cells by competing directly with proteins that contain D-recruitment sites. PMID: 17658892

Show More

Hide All

Subcellular Location
Cytoplasm. Note=Associated with microtubules.
Tissue Specificity
Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals wi
Database Links

HGNC: 8822

OMIM: 603434

KEGG: hsa:8682

STRING: 9606.ENSP00000353660

UniGene: Hs.517216

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*