Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

In Stock
Code CSB-MP5861HU
Abbreviation Recombinant Human CD79A&CD79B Heterodimer protein (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL.Activity
    Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL. Biological Activity Assay
  • The purity of CD79A&CD79B was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL.
Target Names
CD79A&CD79B
Uniprot No.
Alternative Names
/
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-143aa&29-159aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Mol. Weight
41.3 kDa&43.1 kDa
Protein Length
Heterodimer
Tag Info
C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human CD79A&CD79B protein is a co-expressed, biologically active product designed to mimic the native B-cell receptor (BCR) complex component. It is produced in a mammalian expression system to preserve structural fidelity and post-translational modifications. This construct includes amino acids 33–143 of CD79A and 29–159 of CD79B and is tagged with an mFc-Flag at the C-terminus of human CD79A and a 10xHis-mFc at the C-terminus of human CD79B, enabling efficient purification and detection. It demonstrates greater than 95% purity by both SDS-PAGE and SEC-HPLC, with endotoxin levels strictly controlled below 1.0 EU/μg, verified by the LAL method. Functional assays confirm its binding capacity with the anti-CD79A recombinant antibody (CSB-RA004957MA1HU) and the anti-CD79B recombinant antibody (CSB-RA004958MA2HU), with an EC50 of 8.012–9.339 ng/mL and 14.85–17.47 ng/mL, respectively. These results support its use in immunological studies, antibody screening, and B-cell signaling pathway research.

CD79A and CD79B are integral components of the BCR complex, crucial for developing and activating B lymphocytes. CD79A, also known as Igα, and CD79B, known as Igβ, play distinct but complementary roles in modulating B-cell receptor signaling and ensuring effective immune responses.

CD79A and CD79B function as the signaling subunits of the BCR, assisting in the transduction of signals that initiate B-cell activation following antigen recognition. Specifically, both proteins contain immunoreceptor tyrosine-based activation motifs (ITAMs) essential for BCR signaling. When the BCR engages with antigens, CD79A and CD79B undergo phosphorylation, which leads to the recruitment of signaling proteins that activate various downstream pathways, including those mediated by MAP kinases and transcription factors [1][2]. This signaling network stimulates B-cell proliferation, differentiation, and antibody production.

Research indicates that CD79A and CD79B are important for the transition of progenitor B cells to pre-B cells and for the development of mature B cells in response to BCR engagement [3][4]. They contribute to tonic signaling that maintains B cell survival and functionality independently of external signals [1][5]. Furthermore, studies have demonstrated that the interplay between these two molecules is significant for the B-cell response. For example, CD79B is involved in both positive and negative signaling, depending on the nature of the ligand-bound state of the receptor [6][4].

The expression of CD79A and CD79B is tightly regulated throughout B-cell development and differentiation. For instance, CD79B is often downregulated in terminally differentiated plasma cells, reflecting a key transition in the B-cell lifecycle [7]. This downregulation corresponds with the loss of surface immunoglobulin expression, linking CD79B with B-cell receptor activity during antigen-specific responses [7]. Abnormal expression of CD79A and CD79B is also implicated in various B-cell malignancies, including non-Hodgkin lymphoma and chronic lymphocytic leukemia, where altered signaling pathways can lead to uncontrolled proliferation of B cells [8].

In summary, CD79A and CD79B serve critical roles in B-cell development, survival, and activation through their involvement in BCR signaling. Their regulated expression and functional activities are crucial for maintaining normal B-lymphocyte functions and developing certain hematologic malignancies, establishing them as important focal points in B-cell biology and therapeutic research.

References:
[1] X. Huang, K. Takata, et al. Downregulation of the b‐cell receptor signaling component cd79b in plasma cell myeloma: a possible post transcriptional regulation. Pathology International, vol. 61, no. 3, p. 122-129, 2011. https://doi.org/10.1111/j.1440-1827.2010.02634.x
[2] T. Tanaka, K. Ichimura, et al. Frequent downregulation or loss of cd79a expression in plasma cell myelomas: potential clue for diagnosis. Pathology International, vol. 59, no. 11, p. 804-808, 2009. https://doi.org/10.1111/j.1440-1827.2009.02448.x
[3] D. Luger, Y. Yang, et al. Expression of the b-cell receptor component cd79a on immature myeloid cells contributes to their tumor promoting effects. Plos One, vol. 8, no. 10, p. e76115, 2013. https://doi.org/10.1371/journal.pone.0076115
[4] I. Hardy, N. Anceriz, et al. Anti-cd79 antibody induces b cell anergy that protects against autoimmunity. The Journal of Immunology, vol. 192, no. 4, p. 1641-1650, 2014. https://doi.org/10.4049/jimmunol.1302672
[5] H. Brühl, J. Cihak, et al. B‐cell inhibition by cross‐linking cd79b is superior to b‐cell depletion with anti‐cd20 antibodies in treating murine collagen‐induced arthritis. European Journal of Immunology, vol. 45, no. 3, p. 705-715, 2014. https://doi.org/10.1002/eji.201444971
[6] C. Kooten, L. Galibert, B. Seon, P. Garrone, Y. Liu, & J. Banchereau. Cross-linking of antigen receptor via ig-β (b29, cd79b) can induce both positive and negative signals in cd40-activated human b cells. Clinical & Experimental Immunology, vol. 110, no. 3, p. 509-515, 1997. https://doi.org/10.1046/j.1365-2249.1997.4201436.x
[7] E. Yoo, N. Cooke, & S. Liebhaber. Identification of a secondary promoter within the human b cell receptor component gene hcd79b. Journal of Biological Chemistry, vol. 288, no. 25, p. 18353-18365, 2013. https://doi.org/10.1074/jbc.m113.461988
[8] D. Lü, J. Jin, et al. Semi-mechanistic multiple-analyte pharmacokinetic model for an antibody-drug-conjugate in cynomolgus monkeys. Pharmaceutical Research, vol. 32, no. 6, p. 1907-1919, 2014. https://doi.org/10.1007/s11095-014-1585-y

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*