Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

In Stock
Code CSB-MP5861HU
Abbreviation Recombinant Human CD79A&CD79B Heterodimer protein (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL.Activity
    Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL. Biological Activity Assay
  • The purity of CD79A&CD79B was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL.
Target Names
CD79A&CD79B
Uniprot No.
Alternative Names
/
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
33-143aa&29-159aa
Target Protein Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
Mol. Weight
41.3 kDa&43.1 kDa
Protein Length
Heterodimer
Tag Info
C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The CD79A/CD79B heterodimer forms the signaling component of the B-cell receptor complex, making it a critical target for therapeutic antibody development in B-cell malignancies and autoimmune disorders. This mammalian-expressed heterodimer, spanning residues 33–143 of CD79A and 29–159 of CD79B, demonstrates quantified binding to anti-CD79A antibodies with an EC50 of 8.0–9.3 ng/mL and to anti-CD79B antibodies with an EC50 of 14.9–17.5 ng/mL in functional ELISA, providing a validated basis for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody characterization. The mammalian expression system supports native disulfide bonding and glycosylation patterns essential for preserving the conformational epitopes recognized by clinical-stage antibodies targeting this complex. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this heterodimer meets the quality thresholds commonly required for surface plasmon resonance affinity measurements, bio-layer interferometry kinetic studies, and high-throughput drug discovery campaigns focused on B-cell receptor signaling modulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*