Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC50 is 8.012-9.339 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC50 is 14.85-17.47 ng/mL.

Target Names

CD79A&CD79B

Uniprot No.

P11912 P40259

Alternative Names

/

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

33-143aa&29-159aa

Target Protein Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Mol. Weight

41.3 kDa&43.1 kDa

Protein Length

Heterodimer

Tag Info

C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The CD79A/CD79B heterodimer forms the signaling component of the B-cell receptor complex, making it a critical target for therapeutic antibody development in B-cell malignancies and autoimmune disorders. This mammalian-expressed heterodimer, spanning residues 33–143 of CD79A and 29–159 of CD79B, demonstrates quantified binding to anti-CD79A antibodies with an EC50 of 8.0–9.3 ng/mL and to anti-CD79B antibodies with an EC50 of 14.9–17.5 ng/mL in functional ELISA, providing a validated basis for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody characterization. The mammalian expression system supports native disulfide bonding and glycosylation patterns essential for preserving the conformational epitopes recognized by clinical-stage antibodies targeting this complex. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this heterodimer meets the quality thresholds commonly required for surface plasmon resonance affinity measurements, bio-layer interferometry kinetic studies, and high-throughput drug discovery campaigns focused on B-cell receptor signaling modulation.

Code	CSB-MP5861HU
Abbreviation	Recombinant Human CD79A&CD79B Heterodimer protein (Active)
MSDS	MSDS Datasheet
Size	$190
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79A recombinant antibody(CSB-RA004957MA1HU). The EC₅₀ is 8.012-9.339 ng/mL.Activity Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/ml can bind Anti-CD79B recombinant antibody(CSB-RA004958MA2HU). The EC₅₀ is 14.85-17.47 ng/mL. Biological Activity Assay The purity of CD79A&CD79B was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage