Recombinant Human BPI fold-containing family A member 2 (BPIFA2)

Code CSB-YP839308HUe1
Abbreviation Recombinant Human BPIFA2 protein
MSDS
Size $416
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
BPIFA2; C20orf70; SPLUNC2; UNQ510/PRO1025; BPI fold-containing family A member 2; Parotid secretory protein; PSP; Short palate, lung and nasal epithelium carcinoma-associated protein 2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
19-249aa
Target Protein Sequence
ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
No-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human BPIFA2 gets expressed in a yeast system, spanning the full length of the mature protein from amino acids 19 to 249. This tag-free protein demonstrates high purity levels above 90%, which SDS-PAGE analysis has confirmed. The protein is designed strictly for research purposes and appears to offer a dependable tool for scientific studies that require recombinant BPIFA2.

BPIFA2 belongs to the BPI fold-containing family and seems to play an important role in the body's innate immune defense systems. The protein is mainly involved in host defense through antimicrobial activities and likely participates in maintaining balance within the upper respiratory tract. Research interest in BPIFA2 stems from its function in mucosal immunity and possible connections to respiratory health.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant BPIFA2 protein are unknown and cannot be assumed. BPIFA2 is a secreted protein that typically adopts a characteristic BPI-fold structure stabilized by disulfide bonds, which is essential for its proposed functions in innate immunity and surfactant properties. While expression in a yeast system (eukaryotic) is favorable for disulfide bond formation compared to bacterial systems, and the protein is tag-free, representing the full-length mature sequence (19-249aa), there is no verification of correct folding or bioactivity. The >90% purity indicates minimal contaminants but does not confirm proper tertiary structure or functional activity. Therefore, applications relying on specific biological interactions or native conformation are speculative without validation.

1. Antibody Development and Validation Studies

This recombinant BPIFA2 protein is suitable as an immunogen for generating antibodies. The tag-free, full-length nature and high purity are advantageous for presenting potential conformational epitopes. Antibodies generated will be against this yeast-expressed recombinant BPIFA2. Their ability to recognize the natively folded, properly modified BPIFA2 protein in human airway secretions must be empirically validated. The recombinant BPIFA2 protein is reliable for developing detection tools, but functionality in recognizing endogenous protein requires confirmation.

2. Protein-Protein Interaction Studies

The tag-free recombinant BPIFA2 protein can be used in interaction studies. However, the utility for identifying physiological binding partners is entirely contingent on correct folding. BPIFA2 is proposed to interact with bacterial lipopolysaccharides, surfactant lipids, or host proteins in a structure-dependent manner. If misfolded, it will not present native binding surfaces, potentially leading to the identification of non-specific interactors. This application should be considered exploratory until protein folding is validated.

3. Biochemical Characterization and Stability Studies

This recombinant BPIFA2 protein is well-suited for detailed biochemical and biophysical characterization. Techniques like size exclusion chromatography, dynamic light scattering, and stability assays can provide valuable data on its oligomerization state, stability, and solution behavior. This application is valid as it focuses on intrinsic physical properties independent of bioactivity. The tag-free nature is a significant advantage for obtaining data relevant to the native protein's structure.

4. Functional Domain Mapping Studies

The full-length recombinant BPIFA2 protein can serve as a reference for structural studies. Techniques like limited proteolysis and cross-linking mass spectrometry can identify stable domains and structural features of this recombinant BPIFA2 protein, but conclusions about function cannot be drawn without confirming that the protein is bioactive.

Final Recommendation & Action Plan

The immediate priority is to validate the structural integrity and bioactivity of this recombinant BPIFA2 before investing in functional studies. The tag-free, full-length nature and yeast expression are positive indicators. Validation should include: 1) Structural analysis using circular dichroism to verify the characteristic BPI-fold secondary structure; 2) Assessment of disulfide bond formation via non-reducing PAGE or mass spectrometry; and 3) Functional assays if possible (e.g., binding to known ligands like LPS or antimicrobial activity). Once validated, the protein becomes highly valuable for all proposed applications. If activity is confirmed, it would be particularly useful for interaction studies (Application 2) and functional domain mapping (Application 4). If inactive, its use should be focused on antibody production (Application 1) and biophysical characterization (Application 3). The high purity and tag-free nature make this a valuable reagent, but functionality must be established for biologically meaningful conclusions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has strong antibacterial activity against P. aeruginosa.
Gene References into Functions
  1. PSP is a lipopolysaccharide-binding protein that is functionally related to lipopolysaccharide-binding protein, as suggested by their predicted structural similarities PMID: 21833535
  2. multiple SPLUNC2 isoforms are found in the oral cavity and suggest that these proteins may be differentially regulated in distinct tissues where they may function in the innate immune response. PMID: 19499239
Subcellular Location
Secreted.
Protein Families
BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity
Detected in submandibular gland. Secreted into saliva.
Database Links

HGNC: 16203

KEGG: hsa:140683

STRING: 9606.ENSP00000253362

UniGene: Hs.125960

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*