Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF839308HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q96DR5 |
| Relevance | Has strong antibacterial activity against P. aeruginosa. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI |
| Research Area | Developmental Biology |
| Source | in vitro E.coli expression system |
| Gene Names | BPIFA2 |
| Protein Names | Parotid secretory protein |
| Expression Region | 19-249aa |
| Tag Info | Tag-Free |
| Mol. Weight | 25.1kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Has strong antibacterial activity against P. aeruginosa. |
| Subcellular Location | Secreted |
| Protein Families | BPI/LBP/Plunc superfamily, Plunc family |
| Tissue Specificity | Detected in submandibular gland. Secreted into saliva. |
| Database Links |
HGNC: 16203 KEGG: hsa:140683 STRING: 9606.ENSP00000253362 UniGene: Hs.125960 |
BPIFA2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP839308HU | Recombinant Human BPI fold-containing family A member 2(BPIFA2) | Yeast |
| CSB-YP839308HUe1 | Recombinant Human BPI fold-containing family A member 2(BPIFA2) | Yeast |
| CSB-EP839308HU CSB-BP839308HU CSB-MP839308HU |
Recombinant Human BPI fold-containing family A member 2(BPIFA2) | E.coli Baculovirus Mammalian cell |
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Nuclear receptor ROR-gamma(Rorc)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human V-type proton ATPase subunit d 1(ATP6V0D1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cellular tumor antigen p53(TP53)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Immunoglobulin J chain(Jchain)
Express system: E.coli
Species: Mus musculus (Mouse)
