Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Code	CSB-CF839308HU
Size	US$1401
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	BPIFA2
Uniprot No.	Q96DR5
Research Area	Developmental Biology
Alternative Names	bA49G10.1; BPI Fold Containing Family A; Member 2; BPIFA2; C20orf70; chromosome 20 open reading frame 70; Epithelium Carcinoma Associated 2; lung and nasal epithelium carcinoma-associated protein 2; Neonatal submandibular gland protein; Parotid secretory protein; PSP; Short palate; short palate lung and nasal epithelium carcinoma associated 2; short palate; lung and nasal epithelium carcinoma associated protein 2 ; SPLC2_HUMAN; SPLUNC2
Species	Homo sapiens (Human)
Source	in vitro E.coli expression system
Expression Region	19-249aa
Target Protein Sequence	ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	25.1kDa
Protein Length	Full Length of Mature Protein
Tag Info	Tag-Free
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Has strong antibacterial activity against P. aeruginosa.
Gene References into Functions	PSP is a lipopolysaccharide-binding protein that is functionally related to lipopolysaccharide-binding protein, as suggested by their predicted structural similarities PMID: 21833535 multiple SPLUNC2 isoforms are found in the oral cavity and suggest that these proteins may be differentially regulated in distinct tissues where they may function in the innate immune response. PMID: 19499239
Subcellular Location	Secreted
Protein Families	BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity	Detected in submandibular gland. Secreted into saliva.
Database Links	HGNC: 16203 KEGG: hsa:140683 STRING: 9606.ENSP00000253362 UniGene: Hs.125960