Recombinant Human BPI fold-containing family A member 2(BPIFA2)

Code CSB-CF839308HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q96DR5
Relevance Has strong antibacterial activity against P. aeruginosa.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Research Area Developmental Biology
Source in vitro E.coli expression system
Gene Names BPIFA2
Protein Names Parotid secretory protein
Expression Region 19-249aa
Tag Info Tag-Free
Mol. Weight 25.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has strong antibacterial activity against P. aeruginosa.
Subcellular Location Secreted
Protein Families BPI/LBP/Plunc superfamily, Plunc family
Tissue Specificity Detected in submandibular gland. Secreted into saliva.
Database Links

HGNC: 16203

KEGG: hsa:140683

STRING: 9606.ENSP00000253362

UniGene: Hs.125960

Related Products

BPIFA2 Proteins

BPIFA2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.