Your Good Partner in Biology Research
Tel : 301-363-4651
CLDN18.2｜CD20｜Proteinase K｜EGFR｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
Your Good Partner in Biology Research
CLDN18.2｜CD20｜Proteinase K｜EGFR｜PD-L1｜CD276｜ACE2｜TMPRSS2｜Exosome Isolation Kits
| Code | CSB-RP117574h |
| Size |
$1726Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The production of the recombinant human basigin (BSG) is through the expression of the gene fragment mapping within amino acids 138-321 of the human BSG protein in E.coli. This partial-length recombinant BSG protein is tagged with a 6xHis motif at the N-terminus, which allows for purification of this fusion protein through metal affinity chromatography. Its purity is greater than 90% determined by SDS-PAGE. It migrated to the molecular weight band of approximately 25 kDa on the gel. The target protein BSG, also called CD147 or EMMPRIN, is important in vision, spermatogenesis, and other physiological phenomena. It also plays a significant role in the pathogenesis of numerous diseases, including cancer. Recent findings point out that BSG exerts a significant role in SARS-CoV-2 invasion as a binding partner for the SARS-CoV-2 spike protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | BSG |
| Uniprot No. | P35613 |
| Research Area | Cancer |
| Alternative Names | 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 138-321aa |
| Target Protein Sequence | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 24.2kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 6xHis-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 18-28 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
| Function (From Uniprot) |
Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasma membrane. Plays pivotal roles in spermatogenesis, embryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Seems to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Melanosome |
| Tissue Specificity | Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas. |
| Database Links |
HGNC: 1116 OMIM: 109480 KEGG: hsa:682 STRING: 9606.ENSP00000333769 UniGene: Hs.501293 |
Tel: 301-363-4651
Email: [email protected]
Distributors Worldwide
