Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group); Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor
Species
Homo sapiens (Human)
Expression Region
138-321aa
Target Protein Sequence
EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of the recombinant human basigin (BSG) is through the expression of the gene fragment mapping within amino acids 138-321 of the human BSG protein in E.coli. This partial-length recombinant BSG protein is tagged with a 6xHis motif at the N-terminus, which allows for purification of this fusion protein through metal affinity chromatography. Its purity is greater than 90% determined by SDS-PAGE. It migrated to the molecular weight band of approximately 25 kDa on the gel. The target protein BSG, also called CD147 or EMMPRIN, is important in vision, spermatogenesis, and other physiological phenomena. It also plays a significant role in the pathogenesis of numerous diseases, including cancer. Recent findings point out that BSG exerts a significant role in SARS-CoV-2 invasion as a binding partner for the SARS-CoV-2 spike protein.