Recombinant Human Beta-synuclein (SNCB)

In Stock
Code CSB-EP624090HUb1
Abbreviation Recombinant Human SNCB protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SNCB
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-134aa
Target Protein Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease.
Gene References into Functions
  1. Cells that overexpress alpha-syn showed increased susceptibility to the toxicity of the oligomers, while those that overexpressed beta-syn showed increased resistance to the toxic oligomers. PMID: 29054856
  2. alterations in the plasma alpha-synuclein and beta-synuclein levels might be implicated in the association between synaptic abnormalities and autism spectrum disorder pathogenesis. PMID: 29850516
  3. Study suggests that beta-synuclein changes in Dementia with Lewy bodies may exacerbate neuronal dysfunction caused by accumulation of alpha-synuclein by influencing protein degradation. PMID: 29278715
  4. Data suggest that pH serves as an on/off switch for beta- synuclein to form aggregates/fibrils (as seem in Parkinson disease); hydrogen bonding between glutamate residues appears to be involved in fibril formation. PMID: 28710275
  5. Cellular pathways affected by bSyn are similar to those affected by aSyn, including impairment of vesicular trafficking and induction of oxidative stress. PMID: 26586132
  6. loss of inhibitory C-terminal conformations in disease associated P123H beta-synuclein PMID: 26332674
  7. beta-Synuclein expression was locally concentrated and rather modest, but nevertheless changed its effect on amyloid precursor protein expression and plaque load in a time- and concentration-dependent manner. PMID: 26111745
  8. The differing aggregation propensities of alpha-synuclein and beta-synuclein are associated with differences in the degree of residual structure in the C-terminus coupled to the shorter separation between the N- and C-termini in beta-synuclein. PMID: 25389903
  9. Beta-synuclein protects against isoaspartate accumulation in alpha-synuclein. PMID: 23630590
  10. both alphaS- and P123H betaS-globules were formed through similar but distinct pathogenic mechanisms. PMID: 23013868
  11. In vivo cross-linking reveals principally oligomeric forms of alpha-synuclein and beta-synuclein in neurons and non-neural cells PMID: 23319586
  12. Thermodynamic studies in conjunction with EPR confirm that alpha-synuclein, beta-synuclein, and gamma-synuclein bind copper(II) in a high affinity 1:1 stoichiometry. PMID: 21117662
  13. Data provide evidence for the role of beta-synuclein minor transcript variants in the development of complex diseases and provide new insights into the pathogenesis of Lewy body diseases. PMID: 22205345
  14. This study suggested that the pathogenesis of dementia in Parkinson disease, indicating that differential sncb expression in the caudate nucleus may represent one of the molecular mechanisms involved in these complex diseases. PMID: 21683963
  15. Despite both synucleins sharing considerable sequence homology, the level of carboxy-terminal Src kinase-homologous kinase (CHK) phosphorylation of beta-synuclein is significantly higher than that of alpha-synuclein. PMID: 21699177
  16. Transcriptional regulation of the beta-synuclein 5'-promoter metal response element by metal transcription factor-1. PMID: 21386983
  17. Synuclein-alpha, -beta, and -gamma are important in regulating neurotransmitter release from specific populations of midbrain dopamine neurons through mechanisms that differ from those reported in other neurons. PMID: 21593311
  18. Studies identified molecular interaction domains within the beta-synuclein polypeptide that specifically binds alpha-synuclein. PMID: 21085664
  19. beta-Synuclein mRNA expression in the control group was significantly higher than that in the schizophrenic group. PMID: 20854101
  20. A drastic diminution of beta-synuclein expression was observed in cortical areas of all samples that presented neuropathological features corresponding to pure diffuse Lewy body pathology PMID: 20959308
  21. Human beta-synuclein rendered fibrillogenic by designed mutations. PMID: 20833719
  22. Data show that alpha-synuclein, beta-synuclein, and apolipoprotein A-1 have the conserved functional ability to induce membrane curvature and to convert large vesicles into highly curved membrane tubules and vesicles. PMID: 20693280
  23. members of the synuclein gene family, particularly SNCA and SNCG, affect the risk of developing diffuse lewy body disease. PMID: 20697047
  24. Gamma-synuclein protein is valuable for evaluation of progression of colorectal carcinoma; it is more sensitive to predict advanced stage and lymph node invasion when combined with either alpha- or beta-synuclein protein. PMID: 20043104
  25. Biophysical properties of the synucleins and their propensities to fibrillate: inhibition of alpha-synuclein assembly by beta- and gamma-synucleins PMID: 11812782
  26. Of medulloblastomas, 76% have immunoreactivity for either alpha- or beta-synuclein or both; no immunoreactivity for gamma-synuclein is seen in medulloblastomas. PMID: 12783249
  27. Beta-synuclein displays an antiapoptotic p53-dependent phenotype and protects neurons from 6-hydroxydopamine-induced caspase 3 activation: cross-talk with alpha-synuclein and implication for Parkinson's disease. PMID: 12867415
  28. 2 new AA changes were found in unrelated Lewy body dementia index cases: V70M & P123H, at conserved residues in highly conserved regions of the beta-synuclein protein. Mutations in the beta-synuclein gene may predispose to DLB. PMID: 15365127
  29. the alpha- and gamma-synucleins regulate proteasomal function and beta-synuclein acts as a negative regulator of alpha-synuclein PMID: 15591046
  30. An 11-residue deletion in the lipid-binding domain of beta-synuclein leads to the destabilization of an entire segment of the micelle-bound helical structure containing the deletion site. PMID: 16597821
  31. findings indicate that increased expression of beta-synuclein protein results in a reduction of alpha-synuclein protein expression PMID: 16959793
  32. The accumulation of beta-synuclein was detectable only in the pons of Sandhoff disease cases. This differential accumulation of alpha- and beta-synucleins in human lipidoses may be related to functional differences between these two proteins. PMID: 17653558
  33. A comparison of the structural and dynamic properties of the free states of all three synucleins, is reported in order to shed light on differences that may help to explain their different propensities to aggregate. PMID: 17681534
  34. Our data confirm the fatty acid binding properties of alpha-syn, and to a lesser extent beta-syn, but suggest that gamma-syn does not share this same characteristic. PMID: 17692832
  35. structural and functional properties of beta-synuclein were characterized using biochemical and bio-physical methods including: a functional assay, mass spectrometry, size exclusion chromatography, circular dichroism (CD), and fluorescence spectroscopy PMID: 18221001
  36. The aggregation behavior of alpha- and beta-synuclein as well as a series of chimeric variants were compared by exploring the structural transitions that occur in the presence of a widely used lipid mimetic, sodium dodecyl sulfate (SDS). PMID: 18436957

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Synuclein family
Tissue Specificity
Expressed predominantly in brain; concentrated in presynaptic nerve terminals.
Database Links

HGNC: 11140

OMIM: 602569

KEGG: hsa:6620

STRING: 9606.ENSP00000308057

UniGene: Hs.90297

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*