Recombinant Human Biglycan(BGN)

In Stock
Code CSB-EP002683HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P21810
Lead Time 3-7 business days
Relevance May be involved in collagen fiber assembly.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Bone/cartilage proteoglycan I PG-S1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Research Area Signal Transduction
Source E.coli
Gene Names BGN
Protein Names Recommended name: Biglycan Alternative name(s): Bone/cartilage proteoglycan I PG-S1
Expression Region 38-368aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 57.2kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in collagen fiber assembly.
Involvement in disease Meester-Loeys syndrome (MRLS); Spondyloepimetaphyseal dysplasia, X-linked (SEMDX)
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Tissue Specificity Found in several connective tissues, especially in articular cartilages.
Database Links

HGNC: 1044

OMIM: 300106

KEGG: hsa:633

STRING: 9606.ENSP00000327336

UniGene: Hs.821

Q&A and Customer Reviews

Q&A
Q:

I have plane to buy the CSB-EP002683hu protein with powder form.
I have several questions:
1st Is it possible to dissolve it into the saline to the concetration on 3ug/2ul?
2nd How long maintaing the activity of protein with dissolved saline buffer?
3rd Let me know the temperature for storage.

A:
Thanks for choosing Cusabio !
1. You can use deionized sterile water to dissolve the protein directly, no need to use the saline, because the protein itself has salt ions before lyophilization.
You can dissolve the protein according to the concetration on 3ug/2ul, you need to observe if the protein is fully dissolved.
If you need to dissolve a lot of the protein, you'd better dissolve according to the method introduced in the COA.
2. Protein Shelf Life
* The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
* So the shelf life of different proteins won't be exactly the same. We haven’t performed detailed research for this at present.
* The shelf life of liquid-form protein will be 6 months around at -20℃/-80℃.
* The shelf life of lyophilized form is 12 months around at -20℃/-80℃.
* The shelf life of dissolved recombinant protein is 6 months around at -20℃/-80℃. It refers that customer dissolves protein immediately using sterile water once receiving the item, and then add glycerol with certain final concentration, and finally store at -20℃/-80℃, and then the reconstituted protein can be stored for six months. If customers use the protein immediately, then they don't need to add glycerol, and the protein can be stored for about one week at 4℃.
* The above shelf lives are concluded by our current storage experience. The specific shelf life will depend on specific protein.
3.If you don't use the protein immediately and want to store the protein after dissolving it, you'd better add glycerol with certain final concentration, and finally store at -20℃/-80℃, and then the dissolved protein can be stored for six months.
Sorry, we haven't tested the activity of this protein, we can't 100% guarantee it's active.
We just tell you the proper condition and operation to store this protein, not how to maintain the activity, because we haven't tested the activity.
Customer Reviews

Related Products

BGN Antibodies

BGN Antibodies for Homo sapiens (Human)

BGN Antibodies for Human

BGN Proteins

BGN Proteins for Homo sapiens (Human)

BGN ELISA Kit

BGN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.