Recombinant Human Biglycan (BGN)

In Stock
Code CSB-EP002683HU
Abbreviation Recombinant Human BGN protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
BGN; Biglycan; Biglycan proteoglycan; Bone/cartilage proteoglycan I; Dermatan sulphate proteoglycan I; DSPG1 ; PG S1; PG-S1; PGI; PGS1_HUMAN; SEMDX; SLRR1A; Small leucine rich protein 1A
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
38-368aa
Target Protein Sequence
DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Delve into the world of signal transduction with our premium Recombinant Human BGN protein, an essential component of the extracellular matrix. Biglycan, also known as bone/cartilage proteoglycan I or PG-S1, is a small leucine-rich proteoglycan that plays a pivotal role in regulating cell adhesion, growth, and differentiation. Its involvement in key cellular processes and interactions makes it a valuable protein for researchers exploring signal transduction pathways and related mechanisms.

Our Recombinant Human BGN protein is expressed in E. coli, ensuring a high-quality and robust product. It spans the full length of the mature protein, covering the 38-368aa region, retaining the essential functional domains for your experimental needs. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag facilitate efficient protein purification and detection, simplifying your workflow. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human BGN protein is provided as a lyophilized powder, offering you a reliable and consistent tool for your signal transduction research projects.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have plane to buy the CSB-EP002683hu protein with powder form.
I have several questions:
1st Is it possible to dissolve it into the saline to the concetration on 3ug/2ul?
2nd How long maintaing the activity of protein with dissolved saline buffer?
3rd Let me know the temperature for storage.

A:
Thanks for choosing Cusabio !
1. You can use deionized sterile water to dissolve the protein directly, no need to use the saline, because the protein itself has salt ions before lyophilization.
You can dissolve the protein according to the concetration on 3ug/2ul, you need to observe if the protein is fully dissolved.
If you need to dissolve a lot of the protein, you'd better dissolve according to the method introduced in the COA.
2. Protein Shelf Life
* The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
* So the shelf life of different proteins won't be exactly the same. We haven’t performed detailed research for this at present.
* The shelf life of liquid-form protein will be 6 months around at -20℃/-80℃.
* The shelf life of lyophilized form is 12 months around at -20℃/-80℃.
* The shelf life of dissolved recombinant protein is 6 months around at -20℃/-80℃. It refers that customer dissolves protein immediately using sterile water once receiving the item, and then add glycerol with certain final concentration, and finally store at -20℃/-80℃, and then the reconstituted protein can be stored for six months. If customers use the protein immediately, then they don't need to add glycerol, and the protein can be stored for about one week at 4℃.
* The above shelf lives are concluded by our current storage experience. The specific shelf life will depend on specific protein.
3.If you don't use the protein immediately and want to store the protein after dissolving it, you'd better add glycerol with certain final concentration, and finally store at -20℃/-80℃, and then the dissolved protein can be stored for six months.
Sorry, we haven't tested the activity of this protein, we can't 100% guarantee it's active.
We just tell you the proper condition and operation to store this protein, not how to maintain the activity, because we haven't tested the activity.

Target Background

Function
May be involved in collagen fiber assembly.
Gene References into Functions
  1. The differential immunoexpression of perlecan and biglycan in these types of ameloblastomas suggests their participation in the developmental process of these tumors. PMID: 29921372
  2. TLR2 and BGN contribute to sterile inflammation and infertility in man. PMID: 27849015
  3. Results show that Biglycan expression was upregulated by DNA demethylation in tumour endothelial cells from myeloma. PMID: 27295191
  4. Elevated biglycan mRNA expression in adipose tissues of obese women PMID: 27465988
  5. sex-specific allele combinations of BGN, COL5A1, and DCN, as well as eight miRNA recognition sequences, were associated with altered susceptibility to anterior cruciate ligament ruptures PMID: 28927971
  6. high Bgn expression levels promote a more dense collagen architecture, leading to increased tissue stiffness. This increased tissue stiffness leads to higher integrin-beta1 expression on melanoma cells, which promotes their invasiveness. PMID: 28476030
  7. The expression of hBGN in the skeletal muscle of the treated mice was 1.34-fold higher than that of the native mouse Bgn (mBgn). The low transduction efficiency and improved motor functions suggest that biglycan expressed in a small number of muscle fibers was likely to have been secreted and anchored to the cell surface throughout the whole muscular fibers PMID: 27485975
  8. Results identified loss-of-function mutation in BGN gene in patients with an X-linked syndromic form of severe thoracic aortic aneurysms and dissections (TAAD) confirming BGN as causative gene in severe form of TAAD. PMID: 27632686
  9. After the first year of smoking abstinence the levels of BGN expression and carotid-femoral pulse wave velocity are significantly improved as compared to baseline. PMID: 28131044
  10. study reports a temporal relationship between altered placental biglycan expression and subsequent development of fetal growth restriction/small for gestational age. PMID: 28408374
  11. Quantitative polymerase chain reaction for messenger RNA expression from tissue specimens revealed significantly higher expression of Biglycan (p = 0.0008) and Lumican (p = 0.01) and lower expression of Decorin (p < 0.0001) in urothelial carcinoma of bladder PMID: 28459201
  12. Mutation in BGN gene is associated with X-Linked Spondyloepimetaphyseal Dysplasia. PMID: 27236923
  13. biglycan exerts an important role in cell proliferation, migration, invasion and apoptosis in colon cancer. PMID: 26459740
  14. BGN might play an important role on metastasis in human endometrial cancer and it might be a target marker for the molecular therapy of advanced and recurrence endometrial cancer. PMID: 26275380
  15. This study demonstrated that the small leucine-rich proteoglycan BGN accumulates in CADASIL and binds to NOTCH3. PMID: 25578324
  16. Biglycan may have a role in development of vascular damage in smokers PMID: 25463076
  17. BGN is a factor secreted by peritubular cells to modulate FGFR3c signaling and thus contributes to the regulation of spermatogonial maintenance PMID: 25260943
  18. The results suggest that regions within BGN is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties. PMID: 24552666
  19. immunolocalization of decorin and biglycan in samples of first-trimester and term placentas, placenta accreta, invasive mole, and choriocarcinoma PMID: 24117774
  20. Biglycan modulates angiogenesis and bone formation during fracture healing. PMID: 24373744
  21. Data indicate that the biglycan (BGN) CC genotype was significantly over-represented in the control group versus the carpal tunnel syndrome (CTS) group. PMID: 25173489
  22. High expression of BGN in esophageal squamous cell carcinoma indicated aggressive tumor behaviors and predicted a worse clinical outcome. PMID: 24228112
  23. Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755
  24. ADAMTS-4 and its substrate biglycan are involved in tubulogenesis by endothelial cells PMID: 24051360
  25. The concentration of aggrecan, biglycan, and decorin was determined in six regions of the human supraspinatus tendon. PMID: 22329809
  26. Molecular haplotypes within the BGN promoter may contribute to the molecular basis of interindividually different transcriptional BGN regulation, possibly modulating the predisposition to cardiovascular disease-related phenotypes. PMID: 23393390
  27. pancreatic adenocarcinoma patients who presented PG-I expression in the extracellular matrix had worse prognosis compared to those who did not PMID: 23007878
  28. Extracellular soluble biglycan induces the expression of BMP-2 and ALP in human aortic valve interstitial cells primarily via TLR2 and contributes to the proosteogenic effect of oxLDL. PMID: 22982459
  29. Up-regulation of biglycan was significantly correlated with poor tumor differentiation, lymph node metastasis, and distant metastasis in colorectal cancer. PMID: 21879307
  30. Bgn inhibits the major properties of HER-2/neu-transformed cells, which is inversely modulated by the PKC signaling cascade. PMID: 22582394
  31. Data show that granzyme B (GrB) liberated TGF-beta1 from substrates decorin, biglycan and betaglycan. PMID: 22479366
  32. These findings suggested that biglycan is a novel tumor endothelial cell marker and a target for anti-angiogenic therapy PMID: 22374465
  33. Biglycan demonstrated distinctive localization relative to nodules within calcified aortic valves. PMID: 21185747
  34. Biglycan enhances ovalbumin-specific cross-priming by over 80% to histocompatibility class I-restricted T cells in both a Toll-like receptor (TLR)2- and TLR4-pathway-dependent manner in transgenic mice. PMID: 22095710
  35. findings demonstrate that Akt is a downstream signalling component of TGF-beta-mediated biglycan core protein synthesis but not glycosaminoglycan chain hyperelongation in vascular smooth muscle PMID: 21913799
  36. Data revealed a strong induction of several genes encoding components of the extracellular matrix, such as collagens, COMP, IGFBP5 and biglycan. PMID: 21029365
  37. This study demonstrates that elevated expression of biglycan may play an important role in the development and progression of gastric cancer, and could be further evaluated as a biomarker for predication of a poor clinical outcome. PMID: 21998129
  38. Immunoprecipitation analysis revealed that biglycan interacts with both the canonical Wnt ligand Wnt3a and the Wnt coreceptor low-density lipoprotein receptor-related protein 6 (LRP6), possibly via the formation of a trimeric complex. PMID: 21969569
  39. Biglycan and decorin reduced the proliferation of pre-adipocytes, partly by induction of apoptosis. Furthermore, the anti-proliferative capabilities of decorin and biglycan were nullified with removal of GAG side-chains. PMID: 21702857
  40. Differential expression of 4 out of 5 genes related to estrogen metabolism and action (ESR1, ESR2, PGR and BGN) was confirmed in endometriosis. PMID: 21397694
  41. Biglycan impinges on the expression of total epidermal growth factor receptor and possibly, on the cell-surface expression of the receptors, playing a critical role in the regulation of chondrocyte and pericellular matrix homeostasis. PMID: 20367117
  42. expressed decreased in fetal growth restriction placentae PMID: 20591478
  43. Data show that biglycan (BGN) induces of phospholipid transfer protein (PLTP) in aortic valve interstitial cells via stimulation of Toll-like receptor 2, so increased BGN in stenotic valves contributes to the production of PLTP via TLR 2. PMID: 20382708
  44. study shows (1) a detailed description of ectopic ossification (EO) formed by Bgn, Fmod or combined depletion, (2) the role of exercise in modulating EO and (3) that Bgn and Fmod are critical in controlling motor function. PMID: 19422643
  45. has two GAG chains and affinity to collagen PMID: 11979972
  46. BGN expression is regulated by TGFbeta1 in pancreatic tumor cells and has a role in controlling cell growth PMID: 12140283
  47. isoforms of biglycan have a smaller core protein substituted with smaller glycosaminoglycan chains, are N-glycosylated, which demonstrates that a lack in N-glycosylation is not the reason for a smaller core. PMID: 12153565
  48. biglycan showed a unique ability to organize collagen VI into extensive hexagonal-like networks over a time period of only a few minutes PMID: 12354766
  49. regulation of gene expression by transforming growth factor-beta requires MKK6-p38 mitogen-activated protein kinase signaling downstream of Smad signaling PMID: 12538652
  50. Biglycan may be involved in vascular smooth muscle growth & migration through cdk2- & p27-dependent pathways. Changes in its expression may affect arterial susceptibility to vascular injury, & may play a direct role in pathogenesis of vascular lesions. PMID: 15031262

Show More

Hide All

Involvement in disease
Meester-Loeys syndrome (MRLS); Spondyloepimetaphyseal dysplasia, X-linked (SEMDX)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Tissue Specificity
Found in several connective tissues, especially in articular cartilages.
Database Links

HGNC: 1044

OMIM: 300106

KEGG: hsa:633

STRING: 9606.ENSP00000327336

UniGene: Hs.821

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*