Recombinant Human Blood group Rh (CE) polypeptide (RHCE), partial

In Stock
Code CSB-EP324722HU
Abbreviation Recombinant Human RHCE protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
RHCE
Uniprot No.
Research Area
Others
Alternative Names
Rh polypeptide 1 (RhPI) (Rh30A) (RhIXB) (Rhesus C/E antigens)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
379-417aa
Target Protein Sequence
TSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Gene References into Functions
  1. Among the weak D phenotypes in Tunisia, no novel RHD allele was found and almost 90% were caused by alleles of the weak D Type 4 cluster, of which 88% represented the weak D Type 4.0 allele. Based on established RH haplotypes for variant RHD and RHCE alleles and the lack of adverse clinical reports, we recommend D+ transfusions for patients with weak D Type 4.0 in Tunisia. PMID: 29193104
  2. study 94.9% of the partial D samples revealed altered RHCE variant alleles and 5.7% of the samples with altered RHD allele predicted partial c, partial e and the lack of the high prevalence hr(B) and hr(S) antigens. PMID: 27111588
  3. sequence comparisons revealed high sequence similarity between Patr_RHbeta and Hosa_RHCE, while the chimpanzee Rh gene closest to Hosa_RHD was not Patr_RHalpha but rather Patr_RHgamma PMID: 26872772
  4. The purpose of this study was to determine the diversity and frequency of RHD-CE genotypes, predicting partial antigens in patients with sickle cell disease and in African Brazilian donors in order to find, through the use of RH genotyping, more closely matched donors for sickle cell disease patients who are alloimmunised to Rh antigens. PMID: 27177398
  5. The RHCE gene intron 4 of Han Chinese, Tibetans, and Mongols differs from the RHD gene intron 4 in the presence of a 652-bp fragment. PMID: 26579938
  6. Six new RHCE alleles were identified, namely, RHCE*cE84A, RHCE*ce202G, RHCE*ce307T, RHCE*Ce377G, RHCE*ce697G,712G,733G,744C, and RHCE*Ce733G in individuals of diverse racial origin. PMID: 26435076
  7. RHCE*cE94G encodes variable expression of c (RH4). PMID: 26286238
  8. Rh antibodies in SCD patients with RH variants can be clinically significant and, therefore, matching patients based on RH variants should be considered. PMID: 24960646
  9. Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients. PMID: 25582271
  10. An uneven distribution of RH variant alleles between Dogon and Fulani, in Mali. A high incidence of predicted partial-C phenotype encoded by RHCE*Ce-D(4)-ce was found in Fulani. PMID: 25857637
  11. These data showed the presence of the (C)ce(s) haplotype at a low frequency (0.625%) compared to that among Africans in whom it is common. Nevertheless, the presence of RHD-CE-D(s) in Tunisians, even at a lower frequency PMID: 24333089
  12. One allele was found to be the known allele RHCE*Ol.20.01(RHCE*ce733G) and the second was novel: RHCE*Ol.06.02(RHCE*ce254G,733G). PMID: 25695437
  13. RHD*weak partial 4.0 is associated with an altered RHCE*ce(48C, 105T, 733G, 744C, 1025T) allele in the Tunisian population. PMID: 23742316
  14. RHCE*ceMO was present in one in 50 African-American persons with an allele frequency of 0.01, is often linked to RHD*DAU0, and is potentially of clinical significance for transfusion. PMID: 23772606
  15. In addition to hybrid alleles and nucleotide deletion, intronic mutations may be associated with the nonexpression of RhCE antigens. PMID: 23252593
  16. A QMPSF-based method is reliable to individually quantify the exons of both RH genes, including hybrid D-CE genes in compound heterozygous samples. PMID: 23550903
  17. Frequencies of aberrant RHD and RHCE alleles were similar, irrespective of location and ethnicity. PMID: 24033223
  18. A novel RHCE*cE allele, RHCE*cE734C, was found in two probands whose red blood cells had weakened c expression and typed E- with conventional anti-E reagents. PMID: 22958092
  19. RHD*DIVa and RHCE*ceTI almost always, but not invariably, travel together. This haplotype is found in people of African ancestry and the red blood cells can demonstrate aberrant reactivity with anti-C. RHCE*ceTI encodes partial c and e antigens. PMID: 22804620
  20. Low-prevalence Rh antigen STEM (RH49) is encoded by two different RHCE*ce818T alleles that are often in cis to RHD*DOL. PMID: 22738288
  21. The rare RHCE*ceBI allele appears to be in cis either with RHD*DOL1 or with RHD*DOL2 in people of African descent. PMID: 22690701
  22. Two novel RHCE*ce 48C,733G,1006T alleles have been identified: RHD*186T and RHD*DIIIa150C. PMID: 23286557
  23. A novel allele of RHCE, RHCE*cE 907delC, silences c and E and in the homozygous state resulting in a D- - phenotype and production of anti-Rh17. PMID: 21517889
  24. Allele-specific oligonucleotide polymerase chain reaction for the determination of Rh C/c and Rh E/e antigens in thalassaemic patients. PMID: 21251469
  25. Study identifies a novel allele, RHCE*ce 48C, 733G, 941C, 1006T which is predicted to encode 16Cys, 245Val, 314Ala, and 336CyS and was shown to encode c, V/VS, and an altered expression of e and hrB antigens. PMID: 20576012
  26. RHCE*ceAR encodes a partial c (RH4) antigen. PMID: 20932075
  27. The low prevalence Rh antigen, Be(a), is associated with a single nucleotide change in exon 5 of RHCE*ce; that of 662C>G. and This changes proline-221 of Rhce to arginine, which may impose a steric and/or charge-related effect on the protein. PMID: 19951310
  28. JAL and JAHK antigens are expressed by Ce and ce and varients of RhCE protein PMID: 20233350
  29. RHCE represents the ancestral RH position, while RHD is the duplicated gene PMID: 11902138
  30. Molecular analysis of Hor+, Mol+ variants revealed a hybrid gene structure RHCe-D(5)-Ce, in which exon 5 of RHCE (RHCe allele) was replaced by exon 5 of RHD (the so-called RHCeVA allele). PMID: 12084172
  31. strong selection might be working to maintain the RHCE/RHD antigen variation in the two-locus system PMID: 12857961
  32. disruption of f (Rh6) by Arg229 deletion suggests that external loop 4 is a major structural element contributing to the expression of RHCE cis interacting antigenic products. PMID: 14996197
  33. The single-point mutation T500A in exon 4 of the RHCE gene is a molecular basis of the rare Rhesus antigen Ew. PMID: 14996199
  34. A high incidence of Trp16Cys in RHCE ce was seen in sickle cell disease. Many of these patients were heterozygous for VS antigen. cDNA analysis showed that the 2 mutations were on different alleles, weakening expression of the e antigen on RBCs. PMID: 15023184
  35. Review. The genetic, structural, and immunologic features of RHCE are reviewed. PMID: 15373666
  36. RhCE may not function directly in ammonia transport and may be evolving a new function in the RBC membrane. PMID: 16563829
  37. Review. 3-D models of the subunit and oligomeric architecture are proposed, using hydrophobic cluster analysis. PMID: 16584906
  38. Although the F223V substitution is regarded as the initial event in the evolution of the weak D Type 4 cluster, the current DFV allele probably evolved independently, as evident from different RHCE haplotypes PMID: 17900276
  39. It is possible to examine fetal c allele of RHCE gene in the plasma of pregnant women with anti-c by means of a noninvasive method. PMID: 18382999
  40. The nucleotide 340C>T change in RHCE exon 3 (predicted to encode 114Trp) of the RHCE*ce(S)(340) allele is associated with a JAL+ phenotype and the altered expression of the c, V and VS antigens. PMID: 19076333
  41. Homology modeling of the JAL+ RhCE protein suggests that the Arg-->Trp change eliminates a critical loop-stabilizing H-bond between the side chain of Arg114 and the e-specific amino acid Ala226. PMID: 19170983
  42. the previously described RhCeMA and ce(s)(340) alleles encode the JAL antigen. PMID: 19207167
  43. RHcE(M167K) known as E variant I was the most frequent allele, found in 70 of 122 analyzed blood donors in the northwest of Germany. Among 13 referred samples, C typing problems predominated. PMID: 19453979
  44. Single-amino-acid substitutions were the molecular basis for variant RhCE antigen expression in most samples of German blood donors and patients . PMID: 19453980

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Ammonium transporter (TC 2.A.49) family, Rh subfamily
Tissue Specificity
Restricted to tissues or cell lines expressing erythroid characters. Isoform 4g and isoform RhPI-Alpha are expressed in immature erythroblasts but not in mature erythroblasts.
Database Links

HGNC: 10008

OMIM: 111690

KEGG: hsa:6006

STRING: 9606.ENSP00000294413

UniGene: Hs.449968

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*