Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
BNSP; Bone sialoprotein 2; Bone sialoprotein II; BSP; BSP II; BSPII; Cell binding sialoprotein; Cell-binding sialoprotein; IBSP; Integrin binding sialoprotein; Integrin-binding sialoprotein; SIAL_HUMAN; SPII
Species
Homo sapiens (Human)
Expression Region
129-281aa
Target Protein Sequence
AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Unlock the potential of Bone Sialoprotein 2 (BSP2) in your research with our premium Recombinant Human IBSP protein. BSP2, also known as Integrin-Binding Sialoprotein, is an essential component of the extracellular matrix in bone and dentin, playing a crucial role in the process of bone mineralization, cell adhesion, and integrin-mediated signaling pathways. BSP2 is a key protein in the study of bone metabolism, osteoporosis, and dental pathologies, making it an indispensable tool for researchers in these fields.
Our Recombinant Human IBSP protein is expressed in E. coli, ensuring a consistent and reliable product for your research needs. The partial protein length, covering the expression region from 129-281aa, maintains the crucial functional domains of BSP2. An N-terminal 6xHis-SUMO tag has been added to our recombinant IBSP protein to enable straightforward protein purification and detection. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Human IBSP protein is supplied as a lyophilized powder, providing you with a dependable and effective tool for your bone metabolism and integrin-mediated signaling research endeavors.