Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase (ST8SIA4)

Code CSB-EP821630HU
Abbreviation Recombinant Human ST8SIA4 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ST8SIA4
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
ST8SIA4; PST; PST1; SIAT8D; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase; EC 2.4.99.-; Alpha-2,8-sialyltransferase 8D; Polysialyltransferase-1; Sialyltransferase 8D; SIAT8-D; Sialyltransferase St8Sia IV; ST8SiaIV
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-168aa
Target Protein Sequence
KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Gene References into Functions
  1. Different properties of polysialic acids synthesized by the polysialyltransferases ST8SIA2 and ST8SIA4 have been described. PMID: 28810663
  2. our results demonstrate that miR-146a and miR-146b promote proliferation, migration and invasion of FTC via inhibition of ST8SIA4. PMID: 28427206
  3. Data show that miR-181c was inversely correlated with the levels of ST8SIA4 expression in chronic myelocytic leukemia (CML) cell lines and samples. PMID: 27527856
  4. This is the first report to demonstrate a role for a glycosyltransferase in human pluripotent stem cell lineage specification. PMID: 27074314
  5. changes in the glycosylation patterns and sialylation levels may be useful markers of the progression of breast cancer, as well as miR-26a/26b may be widely involved in the regulation of sialylation machinery by targeting ST8SIA4. PMID: 28032858
  6. The polybasic region of the polysialyltransferase ST8Sia-IV binds directly to NCAM. PMID: 28233978
  7. Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans. PMID: 26884342
  8. ST8SIA4 gene is involved in the development of multidrug resistance via PI3K/Akt pathway in chronic myeloid leukemia. PMID: 25855199
  9. this study indicated that sialylation involved in the development of MDR of AML cells probably through ST3GAL5 or ST8SIA4 regulating the activity of PI3K/Akt signaling and the expression of P-gp and MRP1. PMID: 24531716
  10. ST8SiaIV synthesized polySia selectively on a NRP2 glycoform that was characterized by the presence of sialylated core 1 and core 2 O-glycans. PMID: 23801331
  11. The ST8SiaIV/PST polybasic region plays a critical role in substrate recognition. PMID: 22184126
  12. polysialylated NCAM persistence, up-regulated polysialyltransferase-1 mRNA and previously uncovered defective myelin-associated glycoprotein may be early pathogenetic events in adult-onset autosomal-dominant leukodystrophy PMID: 19725832
  13. SIAT8D has a role in neural development and sialic acid synthesis on NCAM PMID: 12138100
  14. Pancreatitis risk was highest in individuals with abnormalities in pancreatic duct(CFTR) and acini (PST1) indicating that PST1 is a modifier gene for CFTR-related idiopathic chronic pancreatitis. PMID: 12227654
  15. The upregulation of ST8SIA4 and the donwregulation of ST8SIA2 by valproic acid in HUVEC and tumor cell lines are reported. PMID: 15710344
  16. polysialyltransferase ST8Sia IV/PST recognizes specific amino acids in the first fibronectin type III repeat of the neural cell adhesion molecule PMID: 16027151
  17. PSA-NCAM and ST8Sia-II/IV Expression Is Increased in Pancreatic Carcinomas PMID: 18384787
  18. Amino acid substitutions in conserved sequences are critical for the protein-specific polysialylation of NCAM. PMID: 19336400

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Protein Families
Glycosyltransferase 29 family
Tissue Specificity
Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
Database Links

HGNC: 10871

OMIM: 602547

KEGG: hsa:7903

STRING: 9606.ENSP00000231461

UniGene: Hs.308628

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*