Recombinant Human COP9 signalosome complex subunit 2 (COPS2)

In Stock
Code CSB-YP753713HU
Abbreviation Recombinant Human COPS2 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
COPS2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
ALIEN; Alien Drosophila himolog of; Alien homolog; COP 9; COP9; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 constitutive photomorphogenic homolog subunit 2; COP9 signalosome complex subunit 2; COPS 2; Cops2; CSN2; CSN2_HUMAN; JAB1 containing signalosome subunit 2; JAB1-containing signalosome subunit 2; SGN 2; SGN2; Signalosome subunit 2; Thyroid Hormone Receptor Interactor15; Thyroid Hormone Receptor Interactor 15; Thyroid receptor-interacting protein 15; TR-interacting protein 15; TRIP 15; TRIP-15; TRIP15
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-443aa
Target Protein Sequence
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) comes from a yeast expression system and spans the complete 443 amino acid protein. The construct includes an N-terminal 6xHis-tag for easier purification and detection. SDS-PAGE analysis shows this product reaches purity levels above 85%. It's intended solely for research purposes and appears to offer a dependable resource for studying protein-protein interactions and related investigations.

COPS2 belongs to the COP9 signalosome, a multi-protein assembly that participates in diverse cellular processes—protein degradation and signal transduction among them. The protein seems to play an important role in controlling the ubiquitin-proteasome pathway, which likely contributes to how cells manage protein stability and activity. Getting a handle on COPS2's function may be key to understanding cellular regulation and homeostasis mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human COPS2 is a component of the multiprotein COP9 signalosome complex that requires precise folding and proper integration into the complex for its functional role in protein degradation regulation. The yeast expression system provides a eukaryotic environment that supports proper protein folding and post-translational modifications, increasing the probability of correct folding compared to bacterial systems. However, as a complex subunit, COPS2's full functional activity depends on proper assembly with other COP9 subunits. The N-terminal 6xHis tag is relatively small but may potentially interfere with complex formation interfaces. While yeast expression provides favorable conditions, experimental validation remains essential to confirm structural integrity and complex assembly capability.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

This application is highly dependent on proper folding validation. COPS2 interactions within the COP9 signalosome require precise tertiary structure. If correctly folded (verified), the protein is suitable for identifying physiological interaction partners with other COP9 subunits. If misfolded/unverified, there is a high risk of non-specific binding or failure to identify genuine complex interactions.

2. Antibody Development and Validation

Antibody development relies primarily on antigenic sequence recognition. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native COPS2 epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, which are still valuable for detection applications.

3. Biochemical Characterization and Stability Studies

These studies are essential for determining folding status regardless of functional state. If correctly folded (verified), characterization provides reliable data on oligomerization, stability, and structural properties. If misfolded/unverified, analysis yields valuable physical property data for this specific preparation.

4. In Vitro Reconstitution Experiments for COP9 Signalosome Complex Assembly

This application requires rigorous folding and functional validation. Complex assembly depends on precise protein-protein interactions. If correctly folded (verified), the protein enables valid reconstitution studies with other COP9 subunits. If misfolded/unverified, assembly experiments will yield misleading results about complex formation mechanisms.

Final Recommendation & Action Plan

The yeast expression system provides favorable folding conditions for this COP9 signalosome subunit, but experimental validation of structural integrity and complex assembly capability is essential before reliable use in functional studies. Begin with Application 3 (Biochemical Characterization) to assess folding quality through size-exclusion chromatography (oligomerization state), circular dichroism spectroscopy, and thermal stability assays. If correct folding is verified, proceed to validate functional activity through complex assembly assays with other COP9 subunits. Once folding and assembly capabilities are confirmed, proceed cautiously with Applications 1 and 4 for interaction studies and complex reconstitution. Application 2 (antibody development) can proceed immediately regardless of folding status. If misfolding is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional interaction and complex assembly studies. For reliable COPS2 research, always include appropriate complex assembly controls and consider using co-expression systems for complete COP9 signalosome studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.
Gene References into Functions
  1. Data indicate that DET1- and DDB1-associated protein 1 (DDA1)-mediated tumor progression is associated with the activation of the NF-kappa B (NFkappaB)/COP9 signalosome 2(CSN2)/glycogen synthase kinase3beta (GSK3beta) pathway. PMID: 26942699
  2. AIBP promotes apoA-1 binding to ABCA1 on the cell membrane of macrophages and prevents ABCA1 protein from CSN2-mediated degradation so as to prevent foam cell formation PMID: 27017521
  3. CSN2 knockdown cells underwent non-apoptotic cell death. PMID: 19400951
  4. demonstrate Alien-MLK2 interaction and also show that MLK2 is able to phosphorylate Alien; Alien, DAX-1 and thyroid hormone receptor mediated transcriptional silencing is strongly enhanced in the presence of active MLK2 PMID: 15062575
  5. Alien and Sin3A reside together in vivo with the vitamin D3 receptor on the human 24-hydroxylase (CYP24) promoter containing vitamin D3 response elements by chromatin immunoprecipitation PMID: 15173382
  6. Data show that Alien binds in vivo and in vitro to NAP1 and modulates its activity by enhancing NAP1-mediated nucleosome assembly on DNA. PMID: 17339334
  7. Protein interactions of Alien involving nucleophosmin, ERCC3, TRIP11, as well as CRSP3. PMID: 17438371
  8. Alien inhibits E2F1 gene expression and cell proliferation. PMID: 17570542
  9. the interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network PMID: 17929852
  10. CSN2 gene was identified in the genome-wide loss-of-function genetic screen as putative tumor suppressor located at 15q21.2. PMID: 17968325
  11. Alien seems to modulate nucleosome assembly activity. This suggests that Alien is acting on chromatin not only through recruitment of histone-modifying activities, but also through enhancing nucleosome assembly. PMID: 18174916
  12. A subunit of the COP9 signalosome interacted physically with the anaphase-promoting complex and showed a genetic instability of cells. PMID: 19535905

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
CSN2 family
Database Links

HGNC: 30747

OMIM: 604508

KEGG: hsa:9318

STRING: 9606.ENSP00000299259

UniGene: Hs.369614

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*