Recombinant Human CUE domain-containing protein 2 (CUEDC2), partial

Code CSB-EP884464HU
Abbreviation Recombinant Human CUEDC2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CUEDC2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
bA18I14.5; C10orf66; Chromosome 10 open reading frame 66 ; CUE domain containing 2; CUE domain-containing protein 2; CUED2; CUED2_HUMAN; Cuedc2; MGC2491; OTTHUMP00000020368
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-226aa
Target Protein Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.
Gene References into Functions
  1. the present study demonstrated that CUEDC2 downregulation prevented DOXinduced cardiotoxicity in H9c2 cells. Therefore, CUEDC2 may be a promising target for the prevention of DOXinduced cardiotoxicity. PMID: 29845245
  2. MicroRNA hsa-miR-324-5p suppresses H5N1 virus replication by targeting the viral PB1 and host CUEDC2. PMID: 30045983
  3. Low CUEDC2 expression is associated with glioma. PMID: 28534933
  4. findings show a correlation between the aberrant expression of CUEDC2, and GLUT3 and LDHA in clinical hepatocellular carcinoma samples, further demonstrating a link between CUEDC2 and the Warburg effect during cancer development PMID: 28325773
  5. Results suggest that decreased expression of CUEDC2 contributes to tumor growth in lung adenocarcinoma, leading to a poor clinical outcome. PMID: 26023733
  6. CUEDC2 plays a crucial role in modulating macrophage function and is associated with both colitis and colon tumorigenesis. PMID: 24882011
  7. High CUEDC2 sensitizes chronic myeloid leukemic cells to imatinib treatment. PMID: 24125838
  8. In response to UV irradiation, CUEDC2 undergoes ERK1/2-dependent phosphorylation and ubiquitin-dependent degradation, leading to APC/C(Cdh1)-mediated cyclin A destruction, cyclin-dependent kinase 2 inactivation, and G1 arrest. PMID: 23776205
  9. a new biological activity for CUEDC2 as the regulator of JAK1/STAT3 signaling and the mechanism by which SOCS3 has been linked to suppression of the JAK/STAT pathway PMID: 22084247
  10. CUEDC2 is a cell-cycle regulator that promotes spindle checkpoint inactivation and releases APC/C from checkpoint inhibition. CUEDC2 is phosphorylated by Cdk1 during mitosis. PMID: 21743465
  11. key factor in endocrine resistance in breast cancer PMID: 21572428
  12. These results identify a key post-translational mechanism that controls progesterone receptor protein levels and for the first time provide an important insight into the function of CUEDC2 in breast cancer proliferation. PMID: 17347654

Show More

Hide All

Involvement in disease
May predict the clinical outcome of tamoxifen therapy of breast cancer patients. Patients with tumors that highly express CUEDC2 do not respond to tamoxifen treatment as effectively as those with tumors with low expression.
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
CUEDC2 family
Tissue Specificity
Significantly up-regulated in breast tumor tissues compared with matched adjacent normal tissues (at protein level). Levels inversely correlate with ESR1 in breast cancers and are lower in low-grade tumors compared to high-grade tumors.
Database Links

HGNC: 28352

OMIM: 614142

KEGG: hsa:79004

STRING: 9606.ENSP00000358953

UniGene: Hs.500874

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*