Recombinant Human Calcium-activated chloride channel regulator 1 (CLCA1), partial

Code CSB-EP005474HU2
Abbreviation Recombinant Human CLCA1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CLCA1
Uniprot No.
Research Area
Immunology
Alternative Names
Calcium-activated chloride channel family member 1;Calcium-activated chloride channel protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
696-914aa
Target Protein Sequence
LYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLFIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQLSIA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC.
Gene References into Functions
  1. Results suggest that CLCA1 is involved in intestinal mucus homeostasis by facilitating processing and removal of mucus to prevent stagnation. PMID: 29885864
  2. CLCA1 suppresses colorectal cancer aggressiveness via inhibition of the Wnt/beta-catenin signaling pathway PMID: 28974231
  3. Increase in TMEM16A activity occurred within minutes of exposure to CLCA1 or after a short treatment with nocodazole, consistent with the hypothesis that CLCA1 stabilizes TMEM16A at the cell surface by preventing its internalization. PMID: 28420732
  4. Data show that calcium-activated chloride channel regulator 1 (CLCA1) and transmembrane protein 16A (TMEM16A) co-localize and physically interact and that CLCA1 increases the level of TMEM16A protein at the cell surface. PMID: 25781344
  5. inhibitor and siRNA transfection studies demonstrated an apparent effect of CLCA1 on ovarian cancer cell aggregation PMID: 26004777
  6. Results confirmed that the low expression of CLCA1 in CRC was associated with tumorigenesis, early metastasis, and high chromosomal instability. Low expression of CLCA1 predicts recurrence and lower survival. PMID: 25603912
  7. These findings demonstrate the ability of hCLCA1 to function as a signaling molecule and activate macrophages, central regulators of airway inflammation. PMID: 24349445
  8. CLCA1 may contribute to promoting spontaneous differentiation and reducing proliferation of Caco-2 cells. PMID: 23593331
  9. CLCA1 expression is significantly related to mucus production in the airway epithelia of smokers and COPD patients, and may contribute to the development and pathogenesis of COPD by inducing mucus production. PMID: 22731784
  10. These data provide both a mechanistic basis for CLCA1 self-cleavage and a novel mechanism for regulation of chloride channel activity specific to the mucosal interface. PMID: 23112050
  11. Increased expression of hCLCA1 in allergic rhinitis was correlated with the expression of MUC5AC. PMID: 20464982
  12. in cultured nasal airway cells, Th2 type cytokines increased hCLCA1 (calcium-activated chloride channel 1) expression in Cystic Fibrosis patients but not mucus expression PMID: 20542744
  13. The 357SS genotype was significantly overrepresented in both patients with meconium ileus and also with a severe CFTR genotype (P = 0.009) and in p.F508del homozygotes (P = 0.002). PMID: 20179644
  14. upregulation in the IL-9- responsive mucus-producing epithelium of asthmatic subjects supports the hypothesis that this channel may be responsible, in part, for the overproduction of mucus in asthmatic subjects PMID: 11842292
  15. transfection of Caco-2 human colon carcinoma cell line with pCLCA1 to investigate the regulation of CLCA-associated chloride conductance in this differentiated epithelial cell line PMID: 12408984
  16. hCLCA1 expression in NCI-H292 cells specifically induces soluble gel-forming mucin production. This Ca2+-activated Cl- channel plays an important role in epithelial-regulated inflammatory responses, including goblet cell metaplasia. PMID: 12568493
  17. polymorphisms in chronic obstructive pulmonary disease PMID: 14985398
  18. Variation of the CLCA1 gene affects patients' susceptibility for childhood and adult asthma in a Japanese population. PMID: 15318163
  19. CLCA1 and CLCA4 may have roles as modulators of the gastrointestinal basic defect in cystic fibrosis PMID: 15490240
  20. conclude that hCLCA1 and mCLCA3 are non-integral membrane proteins and therefore cannot be chloride channels in their own right PMID: 15919655
  21. We successfully cloned a rat brain CLCA (rbCLCA). PMID: 16023076
  22. CACC play a direct role in mucus production by goblet cells and may thus contribute to the pathogenesis of asthma. PMID: 16148052
  23. IL-13 might induce the expression of MUC5AC and hCLCA1 gene and protein in well-differentiated NHBE cells. These cells might also differentiate into goblet cells and become hyperplastic PMID: 16465045
  24. Evidence is given for a role of the CLCA1 hydrolase domain in processing of mature full-length CLCA1 PMID: 16470849
  25. CLCA1 may be a key signaling member that can be targeted with pharmacologic interventions to treat mucus hypersecretion. PMID: 17426222
  26. These data suggest that hCLCA1 may play a role in LPS-induced mucin expression in human airway mucosa. PMID: 17621552
  27. These results suggest that the up-regulated gene expression of CaCC1 exists, which is complicated with mucus hyper-secretion in Chinese asthmatic airway. PMID: 17698377
  28. hClCa1 does not form Ca(2+)-dependent Cl- channels per se. hClCa1 elevates the single channel conductance of endogenous Ca(2+)-dependent Cl- channels by lowering the energy barriers for ion translocation through the pore. PMID: 19307298
  29. genetic polymorphism is associated with childhood asthma PMID: 19530997

Show More

Hide All

Subcellular Location
Secreted, extracellular space. Cell membrane; Peripheral membrane protein; Extracellular side. Note=Protein that remains attached to the plasma membrane appeared to be predominantly localized to microvilli.
Protein Families
CLCR family
Tissue Specificity
Highly expressed in small intestine and colon namely in intestinal basal crypt epithelia and goblet cells, and appendix. Weakly expressed in uterus, testis and kidney. Expressed in the airways epithelium of both asthmatic and healthy patients. Expressed i
Database Links

HGNC: 2015

OMIM: 603906

KEGG: hsa:1179

STRING: 9606.ENSP00000234701

UniGene: Hs.194659

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*