Recombinant Human Calpain-3 (CAPN3), partial

In Stock
Code CSB-EP004497HU
Abbreviation Recombinant Human CAPN3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CAPN3
Uniprot No.
Research Area
Cell Biology
Alternative Names
Calcium-activated neutral proteinase 3;CANP 3;Calpain L3;Calpain p94;Muscle-specific calcium-activated neutral protease 3;New calpain 1;nCL-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
74-417aa
Target Protein Sequence
LYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-regulated non-lysosomal thiol-protease. Proteolytically cleaves CTBP1 at 'His-409'. Mediates, with UTP25, the proteasome-independent degradation of p53/TP53.
Gene References into Functions
  1. We conclude that integrative variants, haplotypes and diplotypes of the CAPN3 rs4344713 and FRMD5 rs524908, as well as DBP and BMI are associated with serum lipid variables in the Jing and Han populations. PMID: 28332615
  2. This study demonstrates that a cluster of patients with Limb-Girdle Muscular Dystrophy Type 2A in a small Mexican village arises from a novel CAPN3 founder mutation. PMID: 28103310
  3. Heterozygosity for c.643_663del21 in CAPN3 results in a myopathy resembling the recessive form. PMID: 27259757
  4. Unrelated families with limb girdle muscular dystrophy shared common haplotypes with homozygote patterns in two families, and a compound heterozygote pattern in the third family. PMID: 27262448
  5. Here, for the first time, we report a new variant in the CAPN3 gene that can be considered as a robust genetics factor causing limb-girdle muscular dystrophy type 2A disease. PMID: 27861222
  6. Genetic analysis of CAPN3 gene by whole exome sequencing revealed five causative variants which had not been reported in the Iranian population before including a novel 6 bp deletion (c.795_800delCATTGA) and four previously reported mutations (c.1939G > T, c.2243G > A, c.2257delGinsAA, and c.2380 + 2T > G) PMID: 27020652
  7. The allele frequency of CAPN3 gene mutation in limb-girdle muscular dystrophy patients was different in patients from Latvia and Lithuania. PMID: 27142102
  8. Studies indicate that gene mutations causing muscle-specific calcium-activated neutral protease 3 protein (CAPN3) defects are responsible for limb-girdle muscular dystrophy type 2A (LGMD2A). PMID: 26363099
  9. We analyzed 76 families affected with LGMD and identified 62 probands with mutations in the CANP3 gene. C.550delA was the most common mutation identified, being found in 78% of the LGMD2A families PMID: 26484845
  10. We identified four novel CAPN3 mutations and demonstrated clinical and pathological heterogeneity in Korean patients with calpainopathy. PMID: 26632398
  11. Cleavage of C-terminal titin by CAPN3 is associated with limb-girdle muscular dystrophy 2A and tibial muscular dystrophy. PMID: 25877298
  12. Calpain-3 over-expression induces p53 activation and redox imbalance in melanoma A375 cells. PMID: 25658320
  13. Phosphorylated CAPN3 is involved in the pathology of limb-girdle muscular dystrophy type 2A through defects in myofibril integrity and/or signaling pathways. PMID: 25252031
  14. results provide evidence that WT CAPN3 can be formed by the iMOC of two different complementary CAPN3 mutants PMID: 25512505
  15. In LGMD2A muscles the activation of the atrophy programme appeared to depend mainly upon induction of the ubiquitin-proteasome system PMID: 23414389
  16. a heterozygous deletion of the entire CAPN3 gene was found in a patients with Limb-girdle muscular dystrophy type 2A PMID: 24715573
  17. The results indicate that PDGF-C upregulation and calpain-3 downregulation are involved in the aggressiveness of malignant melanoma and suggest that modulators of these proteins PMID: 24126726
  18. Suppression of transgenic CAPN3 expression in cardiac tissue prevents cardiac toxicity in a model of limb-girdle muscular dystrophy. PMID: 23908349
  19. Authors found that PLEIAD also interacts with CTBP1 (C-terminal binding protein 1), a transcriptional co-regulator, and CTBP1 is proteolyzed in COS7 cells expressing CAPN3. PMID: 23707407
  20. Lobulated fibers were often encountered in the muscle biopsies of LGMD2A patients. Such fibers were more frequent in patients with 550delA mutation PMID: 23821418
  21. The findings further confirm mutations in CAPN3 as a genetic cause of eosinophilic myositis and highlight eosinophilic infiltration as an early component (or event) of primary calpainopathy. PMID: 21204801
  22. Researchers identified 2 founder mutations in CAPN3, a missense (c.2338G>C; p.D780H) and a splice-site (c.2099-1G>T) mutation, on 2 different haplotype backgrounds in unrelated limb-girdle muscular dystrophy in the Indian Agarwal community. PMID: 23666804
  23. An intronic mutation in CAPN3 causes severe Limb girdle muscular dystrophy 2A in a large inbred family belonging to a genetic isolate in the Italian Alps. PMID: 22486197
  24. All 18 mutations of Chinese LGMD2A patients are distributed along the entire CAPN3 gene; 11 of the mutations are novel, including 4 missense mutations, 5 deletions, and 2 splicing mutations. PMID: 22926650
  25. Alterations in CAPN3 and nuclear factor-kappaB signaling contribute to muscle mass loss in congenital muscular dystrophy. PMID: 22975586
  26. Evidence from patients with limb girdle muscular dystrophies suggests that calpain 3 is needed for the regenerative process. PMID: 22443334
  27. This is the first report on a potential pathogenic CAPN3 gene mutation resulting from an Alu insertion. PMID: 22158424
  28. In resting human skeletal muscle, the majority (87%) of calpain-3 was present in myofibrillar fractions. PMID: 21836041
  29. In our series of patients, six out of the 13 patients (P9-P14) carried mutations in genes not related to facioscapulohumeral muscular dystrophy, that is, CAPN3 and VCP PMID: 21984748
  30. A homozygous transversion mutation in the CAPN3 gene confirms limb-girdle muscular dystrophy type 2A. PMID: 21386772
  31. The benign phenotype observed in association with combined pG222R and pR748Q mutations suggests that limb-girdle muscular dystrophy type 2A may result from a compensatory effect of compound heterozygosity rather than the LGMD2A mutations themselves. PMID: 22006685
  32. Data show that direct sequencing of CAPN3, encoding calpain-3, identified a homozygous deletion c.483delG (p.Ile162SerfsX17). PMID: 21172462
  33. Limb-girdle muscular dystrophy patients carried a new splicing site mutation (c.1536+1G>T) in the CAPN3 gene, which leads to complete retention of intron 12 of the CAPN3 gene and total calpain3 deficiency. PMID: 20477750
  34. 5 different intronic variants (one novel) in CAPN3 that bioinformatic tools predicted would affect RNA splicing, underwent comprehensive studies which were designed to prove they are disease-causing. PMID: 20635405
  35. CARP and its regulator calpain 3 appear to occupy a central position in the important cell fate-governing NF-kappaB pathway in skeletal muscle PMID: 20860623
  36. The major c.550delA mutation in the CAPN3 gene was identified in 70% of Russian patients. PMID: 20517216
  37. Interactions with M-band titin and calpain 3 link myospryn (CMYA5) to tibial and limb-girdle muscular dystrophies. PMID: 20634290
  38. The findings suggest that mutation analysis of the CAPN3 cDNA should use skeletal muscle tissue as materials instead of peripheral blood. PMID: 20533264
  39. calpain 3 participates in the establishment of the pool of reserve cells by decreasing the transcriptional activity of the key myogenic regulator MyoD via proteolysis independently of the ubiquitin-proteasome degradation pathway. PMID: 20139084
  40. reduced expression of calpain 3 was associated with phenotypes related to obesity and insulin resistance PMID: 12075569
  41. effects of type of mutation, amount of calpain in the muscle, gender and ethnicity of affected patients on clinical course (age of onset and ascertainment) were analysed PMID: 12461690
  42. reaction analysis of calpain p94 autolysis and domains PMID: 12482600
  43. The enzyme is preferentially expressed in B- and T-lymphocytes, whereas it is poorly expressed in natural killer cells and almost undetectable in polymorphonuclear cells. PMID: 12882647
  44. The 550delA mutation was present on 76% of CAPN3 (calpain 3) chromosomes that led us to screen general population for this mutation PMID: 14981715
  45. Insertion sequence 1 of p94 acts as internal autoinhibitory propeptide, blocking the active site of p94 from substrates and inhibitors. PMID: 15073171
  46. Ten novel CAPN3 mutations found in concentrated in several exons in Muscular Dystrophies patients PMID: 15221789
  47. This study found that three novel mutations of calpain 3 gene in limb girdle muscular dystrophy type 2A (LGMD2A, calpainopathy). PMID: 15351423
  48. Efficient and stable CAPN3 transgene expression in mouse muscle restores enzyme proteolytic activity without evident toxicity in a calpain 3-deficient mouse model of limb-girdle muscular dystrophy type 2A. PMID: 16290124
  49. Thus, the proteolytic activity of the core of p94 and its deletion mutant lacking NS and IS1 was shown to be strictly Ca(2+)-dependent. We propose a two-stage model of activation of the proteolytic core of p94. PMID: 16533054
  50. the importance of p94-connectin interaction in the control of p94 functions by regulating autolytic decay of p94 PMID: 16627476

Show More

Hide All

Involvement in disease
Limb-girdle muscular dystrophy 2A (LGMD2A)
Subcellular Location
Cytoplasm. Nucleus, nucleolus.
Protein Families
Peptidase C2 family
Tissue Specificity
Isoform I is skeletal muscle specific.
Database Links

HGNC: 1480

OMIM: 114240

KEGG: hsa:825

STRING: 9606.ENSP00000380349

UniGene: Hs.143261

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*