Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
carcinoembryonic ; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACAM 3; CEACAM-3; Ceacam3; CEAM 3; CEAM-3; CEAM3; CEAM3_HUMAN; CGM1; Nonspecific cross reacting antigen; W264; W282
Species
Homo sapiens (Human)
Expression Region
35-155aa
Target Protein Sequence
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 35-155 form the expressed segment for recombinant Human CEACAM3. The calculated molecular weight for this CEACAM3 protein is 29.1 kDa. This CEACAM3 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of CEACAM3, making it easier to detect and purify the CEACAM3 recombinant protein in the later stages of expression and purification.
Carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) is a protein that takes the spotlight in immunology and infectious disease research. Its primary role lies in the immune system, particularly in the host-pathogen interactions. CEACAM3 is featured in studies exploring the mechanisms of bacterial infections, notably its involvement in the recognition and phagocytosis of bacteria by immune cells, especially neutrophils. In infectious disease research, CEACAM3 works as a receptor for specific pathogens, facilitating their uptake and destruction by immune cells. This makes CEACAM3 a key player in our understanding of how the immune system combats bacterial infections. Additionally, CEACAM3 is implicated in broader areas of immunology, contributing to the understanding of innate immune responses. Its involvement in modulating inflammatory reactions and influencing immune cell behavior broadens its significance in the overall immune system function.
