Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3),Partial

In Stock
Code CSB-EP005163HU
Abbreviation Recombinant Human CEACAM3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
CEACAM3
Uniprot No.
Research Area
Immunology
Alternative Names
carcinoembryonic ; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACAM 3; CEACAM-3; Ceacam3; CEAM 3; CEAM-3; CEAM3; CEAM3_HUMAN; CGM1; Nonspecific cross reacting antigen; W264; W282
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
35-155aa
Target Protein Sequence
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.1kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 35-155 form the expressed segment for recombinant Human CEACAM3. The calculated molecular weight for this CEACAM3 protein is 29.1 kDa. This CEACAM3 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of CEACAM3, making it easier to detect and purify the CEACAM3 recombinant protein in the later stages of expression and purification.

Carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) is a protein that takes the spotlight in immunology and infectious disease research. Its primary role lies in the immune system, particularly in the host-pathogen interactions. CEACAM3 is featured in studies exploring the mechanisms of bacterial infections, notably its involvement in the recognition and phagocytosis of bacteria by immune cells, especially neutrophils. In infectious disease research, CEACAM3 works as a receptor for specific pathogens, facilitating their uptake and destruction by immune cells. This makes CEACAM3 a key player in our understanding of how the immune system combats bacterial infections. Additionally, CEACAM3 is implicated in broader areas of immunology, contributing to the understanding of innate immune responses. Its involvement in modulating inflammatory reactions and influencing immune cell behavior broadens its significance in the overall immune system function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.
Gene References into Functions
  1. the findings reveal an integration of the specific innate immune receptor CEACAM3 into the network of more conventional pattern recognition receptors, providing a mechanism by which the innate immune system can unleash its response to a relentless pathogen. PMID: 28886618
  2. CEACAM3 signalling in neutrophils is able to specifically modulate airway inflammation caused by infection with M. catarrhalis. PMID: 27038042
  3. Opacity protein OpaI of Neisseria gonorrhoeae in lipooligosaccharide mutants lost ability to interact with neutrophil-restricted CEACAM3. PMID: 27376801
  4. p-CEA measurement in patients with pleural effusion of uncertain etiology is a safe and cost-effective procedure, everywhere easily available, which may help clinicians in selecting patients for further evaluations PMID: 27521620
  5. Demonstrated the CEACAM3 specificity and a perioperative trend of circulating tumor cells which is coherent with the clinical/pathological considerations in colorectal cancer. PMID: 26556959
  6. COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM PMID: 26162539
  7. The higher expression of CD44v6, integrin-beta1, CA199, and CEA are closely related to the progression and metastasis of pancreatic cancer.[CA199, CD44v6] PMID: 22382453
  8. A failure of CEACAM3-mediated innate immune detection might be linked to the ability of gonococci to cause disseminated infections. PMID: 23630956
  9. Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact PMID: 22948154
  10. CEACAM3 promotes opsonin-independent phagocytosis of CEACAM-binding bacteria. CEACAM3 is the main driver for this process on human granulocytes. PMID: 22469950
  11. the ability of CEACAM3 to coordinate signaling events that not only mediate bacterial uptake, but also trigger the killing of internalized pathogens. PMID: 21216968
  12. CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance PMID: 20047061
  13. CA-19.9 serum tumor marker levels retain independent prognostic value for poor survival in patients with advanced pancreatic cancer. PMID: 20071292
  14. CEACAM3 has a role in internalizing bacteria to epithelial cells PMID: 12571236
  15. CEACAM3 controls human-specific pathogens by the innate immune system. PMID: 14707113
  16. Molecular staging of SLN using real-time RT-PCR for early breast cancer could serve as a useful complement to standard clinicopathological risk factors. PMID: 17071045
  17. Increased p53, CEA, and CA 19-9 serum levels are associated with colorectal cancer. PMID: 17211733
  18. Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features. PMID: 17413979
  19. These data reveal CEACAM3 as a specific innate immune receptor that mediates the opsonin-independent clearance of CEACAM-binding bacteria via Syk, a molecular trigger for functional immunoreceptor responses of both the adaptive and innate immune systems. PMID: 17506820
  20. killing of bulk NK cultures was inhibited by CEA-expressing cells, suggesting that this putative receptor is an inhibitory receptor PMID: 17878338
  21. Increased CA 19-9 level is associated with pancreatic adenocarcinoma and cholangiocarcinoma. PMID: 19089662

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intesti
Database Links

HGNC: 1815

OMIM: 609142

KEGG: hsa:1084

STRING: 9606.ENSP00000349971

UniGene: Hs.11

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*