Recombinant Human Cartilage matrix protein (MATN1)

In Stock
Code CSB-EP013520HU
Abbreviation Recombinant Human MATN1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MATN1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
(Matrilin-1)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-496aa
Target Protein Sequence
SPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human cartilage matrix protein (MATN1) production begins synthesizing the human MATN1 (23-496aa)-encoding gene, which is fused with an N-terminal 6xHis-tag gene. This fused gene is cloned into an appropriate expression vector and introduced into E. coli cells, from which those containing the expression vector are selected. The positive cells are cultured to express the recombinant MATN1 protein, which is harvested from the cell lysate. The recombinant MATN1 protein is purified using affinity chromatography. Its purity is over 85% as determined by SDS-PAGE.

Human cartilage matrix protein, also called Matrilin-1, is encoded by the MATN1 gene and is a crucial component of the cartilage extracellular matrix (ECM). Matrilin-1 acts as an adaptor protein that bridges the collagen II and proteoglycan networks within the cartilage [1]. It forms homotrimers in mature cartilage, with the potential to form homotetramers under certain conditions [2]. Matrilin-1 plays a significant role in collagen fibrillogenesis and organization within the cartilage ECM [1]. It has been associated with the development and aging of articular cartilage, aiding in distinguishing different cartilage types based on its distribution [3]. Furthermore, studies have shown that matrilin-1 is involved in skeletal development, as evidenced by the fact that mice lacking matrilin-1 exhibited alterations in type II collagen fibrillogenesis and organization [1].

References:
[1] X. Huang, D. Birk, & P. Goetinck, Mice lacking matrilin-1 (cartilage matrix protein) have alterations in type ii collagen fibrillogenesis and fibril organization, Developmental Dynamics, vol. 216, no. 4/5, p. 434-441, 1999. https://doi.org/10.1002/(sici)1097-0177(199912)216:4/53.0.co;2-x
[2] A. Klatt, D. Nitsche, B. Kobbe, M. Mörgelin, M. Paulsson, & R. Wagener, Molecular structure and tissue distribution of matrilin-3, a filament-forming extracellular matrix protein expressed during skeletal development, Journal of Biological Chemistry, vol. 275, no. 6, p. 3999-4006, 2000. https://doi.org/10.1074/jbc.275.6.3999
[3] E. Kavanagh and D. Ashhurst, Development and aging of the articular cartilage of the rabbit knee joint: distribution of biglycan, decorin, and matrilin-1, Journal of Histochemistry & Cytochemistry, vol. 47, no. 12, p. 1603-1615, 1999. https://doi.org/10.1177/002215549904701212

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cartilage matrix protein is a major component of the extracellular matrix of non-articular cartilage. It binds to collagen.
Gene References into Functions
  1. polymorphisms associated with mandibular retrognathism PMID: 29407503
  2. Matrilin-1 is an inhibitor of neovascularization PMID: 24692560
  3. this meta-analysis found an overall significant association of rs1149048 polymorphism with risk of AIS, especially in Asian population. PMID: 24469715
  4. The A allele of single nucleotide polymorphism rs1065755 in the MATN1 gene is associated with adolescent idiopathic scoliosis. PMID: 22193623
  5. we concluded that MATN1 SNP is not associated with either adolescent idiopathic scoliosis predisposition or curve severity in Japanese. PMID: 21308753
  6. There is an association between matrilin-1 levels and curve progression in adolescent idiopathic scoliosis. PMID: 20137399
  7. Genotype GG of matrilin-1 gene is indicative of less bracing effectiveness in adolescent idiopathic scoliosis. PMID: 20137728
  8. Matrilin-1 A-domains have a role in cartilage ECM assembly PMID: 20729554
  9. Genotyping results showed Matrilin-1 polymorphism haplotype TGC (ht4; 158T, 7987G, and 8572C alleles) had pronounced risk effect for mandibular prognathism compared with controls. PMID: 20739701
  10. The tagSNP rs1149048 polymorphism in the MATN1 promoter region is associated with both susceptibility and disease severity in adolescent idiopathic scoliosis. PMID: 20092731
  11. Pseudoachondroplasia is associated with mutations in the cartilage oligomatrix protein gene. PMID: 15552564
  12. the tagSNP rs1149048 polymorphism in the MATN1 promoter region was associated with both susceptibility and disease progression in adolescent idiopathic scoliosis . PMID: 18985072

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Database Links

HGNC: 6907

OMIM: 115437

KEGG: hsa:4146

STRING: 9606.ENSP00000362870

UniGene: Hs.150366

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*