Recombinant Human Choriogonadotropin subunit beta 3 (CGB3)

Code CSB-YP3516HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP3516HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP3516HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP3516HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP3516HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
CGB3
Uniprot No.
Alternative Names
Choriogonadotropin subunit beta 3; Choriogonadotropin subunit beta; CG-beta; Chorionic gonadotropin chain beta; CGB3 CGB; CGB5; CGB8
Species
Homo sapiens (Human)
Expression Region
21-165
Target Protein Sequence
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH, FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role in pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
Gene References into Functions
  1. risk for giving birth to a child with cerebral palsy was higher in women who did not have high hCG concentrations in the 1st trimester and low hCG concentrations in the 2nd trimester PMID: 30007247
  2. The presence of hCGbeta positive tumor cells appears to potentially reflect the aggressive behavior of mucoepidermoid carcinoma and adenoid cystic carcinoma PMID: 30197330
  3. Chorionic Gonadotropin, beta Subunit promoted the migration and invasion of CRC in vitro and in vivo but had no effect on the proliferation of tumor cells. PMID: 29357321
  4. the results of this study provide novel evidence supporting a role of hCG in regulating the differentiation of peripheral FOXP3(+) Tregs, which affect the pregnancy outcomes of patients with a history of recurrent implantation failure PMID: 28044377
  5. Serum hCG-beta levels of POD 12 and 14 and the fold increase of hCG-beta levels from POD 12 to 14 significantly predict pregnancy outcomes after fresh and frozen cycles. PMID: 27262839
  6. Data indicate the diagnostic criteria of chorionic gonadotropin beta subunit (beta-hCG) and alpha-Fetoprotein (alphaFP) in CSF and serum, which may advance the early and formal diagnosis of intracranial germ cell tumors (ICGCTs). PMID: 26968839
  7. All pregnancies with serious complications had serum beta-human chorionic gonadotropin levels of 1.0-5.0 mIU/ml. PMID: 26702770
  8. hCGB serum concentrations differed significantly between Asian and European women during the first trimester of pregnancy. PMID: 25858516
  9. reveals a positive feedback loop between glial cells missing 1 and Human chorionic gonadotropin regulating placental hCGbeta expression and cell differentiation PMID: 26503785
  10. For Down syndrome affected pregnancies, the median MoM of first trimester PAPP-A, PlGF, and AFP were significantly reduced, and free-beta-hCG were significantly elevated. PMID: 25846403
  11. First trimester hCGbeta was not associated with placenta accreta. PMID: 24226752
  12. Maternal serum hCGB was not associated with fetal open spina bifida. PMID: 24226839
  13. Data suggest that low serum levels of hCGB/ADAM12 are biomarkers in diagnosis of continued incomplete spontaneous abortion; here, hCGB/ADAM12 indicate success/failure of single dose of misoprostol/oxytocic in treatment of early pregnancy failure. PMID: 26051455
  14. Depending on its source of production, glycoforms of hCG display different biological activities and functions that are essential for pregnancy outcome.[review] PMID: 25707740
  15. CGB was higher in pregnant women with chronic renal insufficiency compared to controls and women with renal disease and normal renal function. PMID: 25395363
  16. Data suggest that initial serum beta-HCG levels in women after transfer of vitrified--warmed cleavage-stage embryos are lower than those after transfer of slow cooled--thawed cleavage-stage embryos. PMID: 25592975
  17. Median free betahCG MoM in the control group was 1.04, and 1.08 (P = 0.859) in the placenta praevia group compared with 0.81 in the abnormally invasive placentation group (P = 0.06). PMID: 25639820
  18. Case Report: Krukenberg tumor presenting as back pain and a positive urine pregnancy test due to elevated urinary CGB. PMID: 24708577
  19. Hyperglycosylated human chorionic gonadotropin is associated with gestational trophoblastic diseases PMID: 25275660
  20. Time-to-pregnancy >/=24 months in spontaneously conceived pregnancies is associated with decreased levels of PAPP-A and free beta-hCG. PMID: 24338604
  21. The concentration of cell-free beta-HCG mRNA in maternal plasma may be applicable to the prenatal diagnosis of placenta accreta. PMID: 25063251
  22. placenta-mediated adverse pregnancy outcome (PMAPO) before term but not PMAPO at term associated with elevated serum level in second trimester PMID: 25767942
  23. no association between prior pre-eclampsia and first trimester pregnancy level PMID: 24304164
  24. CGB - core fragment was isolated from the urine of women, pregnant with normal, molar and hyperemesis gravidarum pregnancies. Larger glycoforms were more abundant in the abnormal pregnancies. PMID: 24905406
  25. In pregnant women with inherited thrombophilia, PAPP-A levels were significantly higher and fbHCG levels were lower during the first trimester. PMID: 23795618
  26. During pregnancy, regulation of hCG beta subunit genes expression correlates with both methylation of their promoters and TFAP2A expression level. PMID: 25063728
  27. Majority of the patients in 15 cases of hCG positive CSs without typical syncytiotrophoblastic cells showed elevated level of human chorionic gonadotropin (hCG)in blood preoperatively. PMID: 24480432
  28. may directly stimulate angiogenesis PMID: 24560494
  29. Expression of beta-hCG may be seen in high-grade osteosarcoma, but frequent beta-hCG immunohistochemical expression by tumor cells, associated with clinically elevated serum beta-hCG, is rare. PMID: 24856811
  30. Unlike the bovine c-terminal peptide of HCG-beta that lacks O-glycans and determinants for circulatory survival, human HCG-beta has extended plasma half-life. PMID: 24239648
  31. results of the experiments showed that hCGbeta action leads to the increase in ERK and AKT kinases phosphorylation in cancer cells and indicate that these biological effects can be achieved independently of human chorionic gonadotropin presence PMID: 24554412
  32. CGB genes 1 and 2, previously considered as pseudogenes, are notably expressed by epithelial cancer cell lines. PMID: 24778026
  33. LC-MS/MS provided in-depth information on hCG variant composition of hCGn (99/642) and hCGbetan (99/692) and hCG variant specificity profiles and facilitated precise classification of the epitopes PMID: 24014048
  34. Hyperglycosylated CGB is superior to traditional hCG for predicting pregnancy outcome after in vitro fertilization. PMID: 24355054
  35. Initial human chorionic gonadotropin values did not predict treatment success in cases with complete hydatidiform mole. PMID: 24379071
  36. hCG isoforms have potential roles as biomarkers of embryo viability for embryo/blastocyst transfer in infertility treatment. PMID: 23439616
  37. Data suggest that hCGB is higher in vaginal washing fluid in cases and suspected cases of PPROM (preterm premature rupture of membranes) than in control subjects; thus, hCGB level in vaginal washing fluid may be diagnostic test/marker for PPROM. PMID: 23510392
  38. Data suggest that during first trimester, women with ectopic pregnancies have lower blood levels of CGB, progesterone, and estradiol and higher levels of luteinizing hormone and follicle stimulating hormone than normal pregnant women. PMID: 23148678
  39. Increases in early beta-chorionic gonadotropin levels are slower in vanishing twins than in singleton and twin pregnancies. PMID: 23541408
  40. Pulmonary adenocarcinoma and bone metastases diagnosed with paraneoplastic secretion of the beta subunit of human chorionic gonadotropin (beta-HCG). PMID: 23337393
  41. hCGbeta induced cell motility via promoting ERK1/2 phosphorylation and MMP-2 upregulation in human prostate cancer DU145 cells. PMID: 23424616
  42. The depth of trophoblastic tissue infiltration into tubal wall in ampullary pregnancies is correlated with serum beta-hCG levels, but not with gestational age. PMID: 23011731
  43. A complex neuroendocrine circuit exists in the retina, involving hCG secreting cells, hCG targets and hCG-release controlling cells. PMID: 23285091
  44. Human CG not only acts as a chemoattractant of regulatory T (Treg) cells but also plays a central role in pregnancy-induced immune tolerance. PMID: 23396945
  45. Elevation of serum human chorionic gonadotropin is associated with intratubular trophoblasts in the contralateral testis. PMID: 23136239
  46. we showed that type 1 and type 2 beta-hCG are highly expressed by villous mononucleated cytotrophoblasts in the early first trimester PMID: 22811468
  47. The serum levels of betahCG were significantly higher in pregnancies which subsequently developed preeclampsia. PMID: 22148978
  48. Ethnic group-specific median for free beta-hCG should be incorporated during first-trimester screening for fetal Down syndrome;The equation of best fit for free beta-hCG was: predicted median free beta-hCG level=465.332x10(-0.024xgestational age in days) PMID: 22365285
  49. Pregnancy-associated plasma protein A and free-beta-hCG values are gestational age specific. PMID: 22367671
  50. analysis of candidate genes revealed four genes that influence fertility: CGB/LHB gene cluster (p = 0.0036), FSHR (p = 0.023), FST (p = 0.023), and INHB; none of the independent SNPs in these genes predicted mortality PMID: 21222045

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glycoprotein hormones subunit beta family
Tissue Specificity
High expression in the placenta throughout pregnancy.
Database Links

HGNC: 1886

OMIM: 118860

KEGG: hsa:1082

UniGene: Hs.172944

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×