Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CBX7

Uniprot No.

O95931

Research Area

Transcription

Alternative Names

CBX7; Chromobox protein homolog 7

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-251aa

Target Protein Sequence

MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.3kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-251 form the expressed segment for recombinant Human CBX7. This CBX7 protein is theoretically predicted to have a molecular weight of 32.3 kDa. This CBX7 recombinant protein is manufactured in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of CBX7, making it easier to detect and purify the CBX7 recombinant protein in the later stages of expression and purification.

Chromobox protein homolog 7 (CBX7) is a protein that regulates gene expression, with one of its most prominent research areas centered around its role in cancer development. The abnormal expression of CBX7 in various cancer types is associated with tumor growth, invasion, and metastasis. Researchers are endeavoring to unveil the molecular mechanisms of CBX7 in the initiation and progression of cancer, aiming to provide new targets for cancer treatment and prevention. Additionally, CBX7's research in stem cells and genomic stability is of great interest. CBX7 is involved in cell fate determination and the self-renewal processes of stem cells, influencing cellular functions under normal physiological conditions. Its regulatory role in the genome involves changes in chromatin structure, making it crucial for understanding cellular development and differentiation processes.

Target Background

Function

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.

Gene References into Functions

Study found that Cbx7 was downregulated in glioma cell lines and tumors and identifies it as an inhibitor of glioma cell migration through its inhibitory effect on YAP/TAZ-CTGF-hippo signaling axis and underscores the importance of epigenetic inactivation of Cbx7 in gliomagenesis. PMID: 27291091
CBX7 inhibits epithelial-to-mesenchymal transformation and invasion in glioma PMID: 28388562
our results validate the assumption that CBX7 is a tumor suppressor of gliomas. Moreover, CBX7 is a potential and novel prognostic biomarker in glioma patients. We also clarified that CBX7 silences CCNE1 via the combination of CCNE1 promoter and the recruitment of HDAC2. PMID: 28460453
Suggest CBX7 is an important tumor suppressor that negatively modulates PTEN/Akt signaling during pancreatic tumorigenesis. PMID: 28030829
Data suggest that miR-375 leads to the activation of oncogenic signatures and tumor progression by targeting chromobox homolog 7 protein (CBX7). PMID: 27449098
the miR-9 family of microRNAs (miRNAS) downregulates the expression of CBX7. In turn, CBX7 represses miR-9-1 and miR-9-2 as part of a regulatory negative feedback loop. PMID: 26416703
these results suggest that the retention of CBX7 expression may play a role in the modulation of chemosensitivity of lung cancer patients to the treatment with irinotecan and etoposide PMID: 26216446
Cbx7 is downregulated in CCs, and Cbx7 expression-low tumors correlated with lymph metastasis and poor overall survival of CC patients. PMID: 25881303
CBX7/HMGA1b/NF-kappaB could take part in the same transcriptional mechanism that finally leads to the regulation of SPP1 gene expression in papillary thyroid carcinoma. PMID: 25595895
Aberrantly expressed miR-9 contributes to T24 cells invasion, partly through directly down-regulating CBX7 protein expression in bladder transitional cell carcinoma PMID: 25596753
Results suggest that the loss of CBX7 expression might play a critical role in advanced stages of carcinogenesis by deregulating the expression of specific effector genes. PMID: 24865347
we showed for the first time that CBX7 was associated with a decreased prognosis for clear cell adenocarcinoma of the ovary PMID: 24375438
cbx7 expression was significantly downregulated in multiple human cancer tissues. PMID: 22041561
MicroRNA regulation of Cbx7 mediates a switch of Polycomb orthologs during ESC differentiation. PMID: 22226354
These data suggest that CBX7 is a tumor suppressor and that its loss plays a key role in the pathogenesis of cancer. PMID: 22214847
found that expression of CBX7 in gastric carcinoma tissues with p16 methylation was significantly lower than that in their corresponding normal tissues, which showed a negative correlation with transcription of p16 in gastric mucosa PMID: 21060834
CBX7 acts as an oncogene in the carcinogenesis and progression of gastric cancer, and it may regulate tumorigenesis, cell migration and cancer metastasis partially via p16(INK4a) regulatory pathway. PMID: 20723236
data reported indicate that the evaluation of CBX7 expression may represent a valid tool in the prognosis of colon cancer since a reduced survival of colorectal cancer patients is associated with the loss of CBX7 expression. PMID: 20542683
Data show that chromobox 7 (CBX7) within the polycomb repressive complex 1 binds to ANRIL, and both CBX7 and ANRIL are found at elevated levels in prostate cancer tissues. PMID: 20541999
In human glioma, CBX7 is down-regulated by the inhibition of miR-9 at posttranscriptional level. PMID: 18686603
controls cellular lifespan through regulation of both the p16(Ink4a)/Rb and the Arf/p53 pathways PMID: 14647293
CBX7 represses melanoma, p16, inhibits CDK4 and p14Arf expression in normal and tumor-derived prostate cells, affecting their growth PMID: 15897876
CBX7 is a chromobox protein causally linked to cancer development PMID: 17374722
Loss of the CBX7 gene expression correlates with a highly malignant phenotype in thyroid cancer PMID: 18701502
Downregulation of CBX7 is associated with urothelial tumor progression. PMID: 18984978
the ability of CBX7 to positively regulate E-cadherin expression by interacting with HDAC2 and inhibiting its activity on the E-cadherin promoter would account for the correlation between the loss of CBX7 expression and a highly malignant phenotype PMID: 19706751

Hide All

Subcellular Location

Nucleus.

Database Links

HGNC: 1557

OMIM: 608457

KEGG: hsa:23492

STRING: 9606.ENSP00000216133

UniGene: Hs.356416

Code	CSB-EP004603HU
Abbreviation	Recombinant Human CBX7 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Chromobox protein homolog 7 (CBX7)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage