Recombinant Human Chromobox protein homolog 7 (CBX7)

Code CSB-YP004603HU
Abbreviation Recombinant Human CBX7 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
CBX7
Uniprot No.
Research Area
Transcription
Alternative Names
CBX7; Chromobox protein homolog 7
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-251aa
Target Protein Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant human chromobox protein homolog 7 (CBX7) in yeast involves several stages. Initially, the gene encoding the full-length CBX7 protein (1-251aa) is cloned into an expression vector and introduced into yeast cells. The cells are cultured under conditions that induce protein expression. Once sufficient growth is achieved, the cells are lysed to release the recombinant CBX7 protein, which is purified by affinity chromatography. Protein purity is assessed using SDS-PAGE, exceeding 90%.

The Human CBX7 protein, a member of the Polycomb group family, acts as a tumor suppressor in different types of cancers by inhibiting cell growth, inducing apoptosis, and regulating cell motility [1]. It downregulates the expression of the INK4a/ARF tumor suppressor locus, thereby extending the lifespan of normal human cells [2]. Studies have shown that CBX7 is involved in regulating gene expression, such as cyclin E, and interacts with other proteins like HMGA1b to modulate cell cycle progression and cancer development [3]. CBX7 can repress tumor suppressor loci independently of BMI-1 in lymphomagenesis [4].

Furthermore, the downregulation of CBX7 is associated with a more malignant phenotype in thyroid cancer and colon carcinomas, highlighting its significance as a potential biomarker for cancer prognosis [5][6]. In cervical cancer, decreased expression of CBX7 has been identified as an independent predictor of poor survival [7].

References:
[1] R. Li, Q. Yan, P. Tian, Y. Wang, J. Wang, T. Ninget al., Cbx7 inhibits cell growth and motility and induces apoptosis in cervical cancer cells, Molecular Therapy — Oncolytics, vol. 15, p. 108-116, 2019. https://doi.org/10.1016/j.omto.2019.09.002
[2] X. Zhang, L. Zhang, W. Qin, Y. Xiao, L. Zheng, X. Liuet al., Oncogenic role of the chromobox protein cbx7 in gastric cancer, Journal of Experimental & Clinical Cancer Research, vol. 29, no. 1, 2010. https://doi.org/10.1186/1756-9966-29-114
[3] R. Sepe, U. Formisano, A. Federico, F. Forzati, A. Bastos, D. Angeloet al., Cbx7 and hmga1b proteins act in opposite way on the regulation of the spp1 gene expression, Oncotarget, vol. 6, no. 5, p. 2680-2692, 2015. https://doi.org/10.18632/oncotarget.2777
[4] C. Scott, J. Gil, E. Hernando, J. Teruya‐Feldstein, M. Narita, D. Martínezet al., Role of the chromobox protein cbx7 in lymphomagenesis, Proceedings of the National Academy of Sciences, vol. 104, no. 13, p. 5389-5394, 2007. https://doi.org/10.1073/pnas.0608721104
[5] P. Pallante, A. Federico, M. Berlingieri, M. Bianco, A. Ferraro, F. Forzatiet al., Loss of the cbx7 gene expression correlates with a highly malignant phenotype in thyroid cancer, Cancer Research, vol. 68, no. 16, p. 6770-6778, 2008. https://doi.org/10.1158/0008-5472.can-08-0695
[6] X. Zheng, J. Zhou, B. Zhang, J. Zhang, J. Wilson, L. Guet al., Critical evaluation of cbx7 downregulation in primary colon carcinomas and its clinical significance in chinese patients, BMC Cancer, vol. 15, no. 1, 2015. https://doi.org/10.1186/s12885-015-1172-6
[7] L. An, J. Zhang, Z. Jin, Y. Xia, P. Wang, W. Ouyanget al., Decreased expression of cbx7 is an independent predictor of poor survival in cervical cancer,, 2021. https://doi.org/10.21203/rs.3.rs-371414/v1

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity.
Gene References into Functions
  1. Study found that Cbx7 was downregulated in glioma cell lines and tumors and identifies it as an inhibitor of glioma cell migration through its inhibitory effect on YAP/TAZ-CTGF-hippo signaling axis and underscores the importance of epigenetic inactivation of Cbx7 in gliomagenesis. PMID: 27291091
  2. CBX7 inhibits epithelial-to-mesenchymal transformation and invasion in glioma PMID: 28388562
  3. our results validate the assumption that CBX7 is a tumor suppressor of gliomas. Moreover, CBX7 is a potential and novel prognostic biomarker in glioma patients. We also clarified that CBX7 silences CCNE1 via the combination of CCNE1 promoter and the recruitment of HDAC2. PMID: 28460453
  4. Suggest CBX7 is an important tumor suppressor that negatively modulates PTEN/Akt signaling during pancreatic tumorigenesis. PMID: 28030829
  5. Data suggest that miR-375 leads to the activation of oncogenic signatures and tumor progression by targeting chromobox homolog 7 protein (CBX7). PMID: 27449098
  6. the miR-9 family of microRNAs (miRNAS) downregulates the expression of CBX7. In turn, CBX7 represses miR-9-1 and miR-9-2 as part of a regulatory negative feedback loop. PMID: 26416703
  7. these results suggest that the retention of CBX7 expression may play a role in the modulation of chemosensitivity of lung cancer patients to the treatment with irinotecan and etoposide PMID: 26216446
  8. Cbx7 is downregulated in CCs, and Cbx7 expression-low tumors correlated with lymph metastasis and poor overall survival of CC patients. PMID: 25881303
  9. CBX7/HMGA1b/NF-kappaB could take part in the same transcriptional mechanism that finally leads to the regulation of SPP1 gene expression in papillary thyroid carcinoma. PMID: 25595895
  10. Aberrantly expressed miR-9 contributes to T24 cells invasion, partly through directly down-regulating CBX7 protein expression in bladder transitional cell carcinoma PMID: 25596753
  11. Results suggest that the loss of CBX7 expression might play a critical role in advanced stages of carcinogenesis by deregulating the expression of specific effector genes. PMID: 24865347
  12. we showed for the first time that CBX7 was associated with a decreased prognosis for clear cell adenocarcinoma of the ovary PMID: 24375438
  13. cbx7 expression was significantly downregulated in multiple human cancer tissues. PMID: 22041561
  14. MicroRNA regulation of Cbx7 mediates a switch of Polycomb orthologs during ESC differentiation. PMID: 22226354
  15. These data suggest that CBX7 is a tumor suppressor and that its loss plays a key role in the pathogenesis of cancer. PMID: 22214847
  16. found that expression of CBX7 in gastric carcinoma tissues with p16 methylation was significantly lower than that in their corresponding normal tissues, which showed a negative correlation with transcription of p16 in gastric mucosa PMID: 21060834
  17. CBX7 acts as an oncogene in the carcinogenesis and progression of gastric cancer, and it may regulate tumorigenesis, cell migration and cancer metastasis partially via p16(INK4a) regulatory pathway. PMID: 20723236
  18. data reported indicate that the evaluation of CBX7 expression may represent a valid tool in the prognosis of colon cancer since a reduced survival of colorectal cancer patients is associated with the loss of CBX7 expression. PMID: 20542683
  19. Data show that chromobox 7 (CBX7) within the polycomb repressive complex 1 binds to ANRIL, and both CBX7 and ANRIL are found at elevated levels in prostate cancer tissues. PMID: 20541999
  20. In human glioma, CBX7 is down-regulated by the inhibition of miR-9 at posttranscriptional level. PMID: 18686603
  21. controls cellular lifespan through regulation of both the p16(Ink4a)/Rb and the Arf/p53 pathways PMID: 14647293
  22. CBX7 represses melanoma, p16, inhibits CDK4 and p14Arf expression in normal and tumor-derived prostate cells, affecting their growth PMID: 15897876
  23. CBX7 is a chromobox protein causally linked to cancer development PMID: 17374722
  24. Loss of the CBX7 gene expression correlates with a highly malignant phenotype in thyroid cancer PMID: 18701502
  25. Downregulation of CBX7 is associated with urothelial tumor progression. PMID: 18984978
  26. the ability of CBX7 to positively regulate E-cadherin expression by interacting with HDAC2 and inhibiting its activity on the E-cadherin promoter would account for the correlation between the loss of CBX7 expression and a highly malignant phenotype PMID: 19706751

Show More

Hide All

Subcellular Location
Nucleus.
Database Links

HGNC: 1557

OMIM: 608457

KEGG: hsa:23492

STRING: 9606.ENSP00000216133

UniGene: Hs.356416

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*