Recombinant Human Clathrin light chain A(CLTA)

Code CSB-EP005591HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P09496
Relevance Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Research Area Neuroscience
Source E.coli
Gene Names CLTA
Protein Names Recommended name: Clathrin light chain A Short name= Lca
Expression Region 1-218aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.7kDa
Protein Description Full Length of Isoform Non-brain
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge
Subcellular Location Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, spindle
Protein Families Clathrin light chain family
Database Links

HGNC: 2090

OMIM: 118960

KEGG: hsa:1211

STRING: 9606.ENSP00000242285

UniGene: Hs.522114

Pathway Endocytosis
Synaptic vesicle cycle

Related Products

CLTA Antibodies

CLTA Antibodies for Homo sapiens (Human)

CLTA Antibodies for Human

CLTA Proteins

CLTA Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.