Recombinant Human Coactosin-like protein (COTL1)

Code CSB-EP622751HU
Abbreviation Recombinant Human COTL1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
COTL1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CLP; Coactosin like 1; Coactosin-like protein; COTL1; COTL1_HUMAN; FLJ43657; MGC19733
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-142aa
Target Protein Sequence
ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
Gene References into Functions
  1. Study uncovers a novel tumor-suppressor role for CLP/Cotl1 and identify the downstream effectors interleukin 24 (IL-24)/PERP and IL-24/MAPK/ERK/TGF-beta. PMID: 28925397
  2. our combined results elucidated genetic and epigenetic silencing of miR-506-3p enhances COTL1 oncogene expression to foster NSCLC progression. PMID: 27893417
  3. The roles of CLP and FLAP in in cellular leukotriene biosynthesis, were studied. PMID: 25034252
  4. COTL1 regulates lamellipodia dynamics in part by protecting F-actin from cofilin-mediated disassembly. PMID: 24454796
  5. PAI-RBP1 and C1orf142 expression levels are higher in 95D (high metastatic potential) than in 95C (low metastatic potential) non-small lung cancer cells, whereas COTL1 expression level is lower in 95D when compared to 95C cells. PMID: 22373659
  6. Up-regulated COTL-1 expression in small cell lung cancer was validated by Western blot analysis, immunohistochemistry, and qRT-qPCR. PMID: 21047053
  7. Results of the present study support a role for CLP as a chaperoning scaffold factor, influencing both the stability and the activity of 5-LO. PMID: 19807693
  8. CLP 57-65 peptide elicits immediate-type hypersensitivity. Identical peptides are recognized by cellular and humoral immune systems to a tumor-associated antigen. CLP 15-24 and 104-113 might be used for peptide-based immunotherapy of HLA-A2(+) cancers. PMID: 11870627
  9. NMR resonance assignments and the secondary structures of human Coactosin like protein (hCLP) D123N PMID: 15213466
  10. coactosin-like protein (CLP) is an actin-binding protein as well as a 5-lipoxygenase binding partner PMID: 15333945
  11. structural analysis shows that CLP forms a polymer along the crystallographic b axis with the exact same repeat distance as F-actin; a model for the CLP polymer and F-actin binding has therefore been proposed. PMID: 15459340
  12. preliminary crystallographic studies of human coactosin-like protein (CLP) PMID: 15583396
  13. Coactosin-like protein (CLP) up-regulates Ca(2+)-induced 5-lipoxygenase (5LO) activity, and increases the amount of Leukotriene A(4) formed by 5LO. PMID: 16924104
  14. extended region of beta4-beta5 of hCLP (residue 66-75) was found very flexible and very important for F-actin binding. The C-terminal residues of human coactosin-like protein were not involved in F-actin binding PMID: 17070122
  15. We found that coactosin-like1 (COTL1) were highly expressed in rheumatoid arthritis patients compared with healthy controls PMID: 19307756

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Nucleus.
Protein Families
Actin-binding proteins ADF family, Coactosin subfamily
Tissue Specificity
Widely expressed with highest levels in placenta, lung, kidney and peripheral blood leukocytes and lower levels in brain, liver and pancreas.
Database Links

HGNC: 18304

OMIM: 606748

KEGG: hsa:23406

STRING: 9606.ENSP00000262428

UniGene: Hs.289092

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*