Recombinant Human Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2)

Code CSB-YP897588HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP897588HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP897588HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP897588HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP897588HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
CHCHD2
Uniprot No.
Alternative Names
16.7kD protein; Aging Associated Gene 10 Protein; Aging-associated gene 10 protein; C7orf17; CHCH2_HUMAN; CHCHD 2; CHCHD2; Coiled Coil Helix Coiled Coil Helix Domain Containing 2; Coiled coil helix coiled coil helix domain containing protein 2; mitochondrial; Coiled-coil-helix-coiled-coil-helix domain-containing protein 2; mitochondrial; HCV NS2 trans regulated protein; HCV NS2 trans-regulated protein; NS2TP
Species
Homo sapiens (Human)
Expression Region
1-151
Target Protein Sequence
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen).
Gene References into Functions
  1. two genetic CHCHD10 disease variants, G66V and P80L, in the mitochondria exhibit faulty interactions with MNRR1 and COX, reducing respiration and increasing reactive oxygen species (ROS), and in the nucleus abrogating transcriptional repression of ORE-containing genes. PMID: 29540477
  2. It does not play a major role in pathogenesis of mitochondrial myopathy. PMID: 29519717
  3. our study suggests that mutations in the CHCHD2 gene are not likely to be a common cause of Parkinson's disease in Chinese Han population PMID: 27118487
  4. The results of this study suggest that CHCHD2 exonic variants are rare among Chinese patients with Parkinson's disease. PMID: 27269965
  5. Its mutation is not arelevant cause of Parkinson's disease in Italian population. PMID: 28108040
  6. CHCHD2 gene may not play a major role in our familial Chinese Han essential-tremor and Parkinson's disease patients. PMID: 27814991
  7. CHCHD2 is probably not involved in the etiopathogenesis of PD in a southern Spanish population. PMID: 27839904
  8. CHCHD2 mutations might not be the common cause of PD in South Italy. PMID: 27839905
  9. We examined the association of rs10043 and Pro2Leu variants in CHCHD2 with Parkinson's disease. Our study shows a twofold increase of the Pro2Leu variant in CHCHD2 in Parkinson's disease and meta-analysis of published studies suggests that this may be a risk factor for Parkinson's disease in Asian populations PMID: 27626775
  10. CHCHD2 mutations may be rare in Chinese familial essential tremor patients PMID: 27717833
  11. A family with Charcot-Marie-Tooth disease type 1A with an exaggerated phenotype harbors a Q112H mutation in MNRR1, located in a domain that is necessary for transcriptional activation by MNRR1 PMID: 27913209
  12. CHCHD2 primes neuroectodermal differentiation of human embryonic stem cell and Human induced pluripotent stem cell by binding and sequestering SMAD4 to the mitochondria, resulting in suppression of the activity of the TGFbeta signaling pathway. PMID: 27810911
  13. The results of this study suggest that genetic variants of CHCHD2 may not be a frequent cause of MSA or ALS in our Chinese population. PMID: 27538669
  14. Genetic variants of CHCHD2 do not play a major role in Taiwanese patients with Parkinson disease. PMID: 26725463
  15. Autosomal dominant Parkinson's disease can be caused by CHCHD2 mutations and show that the Pro2Leu variant in CHCHD2 may be a risk factor for sporadic PD in Chinese populations. PMID: 26705026
  16. CHCHD2 mutations may not account for PD in Canadian patients. PMID: 26639156
  17. CHCHD2 mutations might not be a common cause of PD in Chinese familial cases. PMID: 26343503
  18. identified a nonsense variant in exon 3 of CHCHD2 (NM_016139, c.376C > T, p.Gln126X; figure, B) in one German patient with Parkinson disease PMID: 26764027
  19. CHCHD2 influences mitochondrial and nuclear functions and contributes to the cancer phenotype associated with 7p11.2 amplification in non-small cell lung carcinoma . PMID: 25784717
  20. The presence of any rare variants in CHCHD2 were more common in Lewy body disease patients with Parkinson's disease compared to controls. PMID: 26561290
  21. The results of the present study indicated that CHCHD2 may be a novel biomarker for hepatocellular carcinoma and that CREB is important in the transcriptional activation of CHCHD2 by HCV NS2. PMID: 25625293
  22. findings establish CHCHD2, a previously uncharacterized small mitochondrial protein with no known homology to the Bcl-2 family, as one of the negative regulators of mitochondria-mediated apoptosis. PMID: 25476776
  23. MNRR1 (formerly CHCHD2) is imported to the mitochondrial intermembrane space by a Mia40-mediated pathway, where it binds to cytochrome c oxidase (COX). PMID: 25315652
  24. CHCHD2 missense mutations are associated with autosomal dominant Parkinson's disease. PMID: 25662902
  25. Silencing CHCHD2 reduces cellular oxygen consumption and disrupts the assembly and activity of Cytochrome C Oxidase. PMID: 19680543

Show More

Hide All

Involvement in disease
Parkinson disease 22 (PARK22)
Subcellular Location
Nucleus. Mitochondrion. Mitochondrion intermembrane space.
Database Links

HGNC: 21645

OMIM: 616244

KEGG: hsa:51142

STRING: 9606.ENSP00000378812

UniGene: Hs.389996

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1