Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial

Code CSB-YP005653HU
Abbreviation Recombinant Human CNKSR2 protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CNKSR2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CNKSR2; CNK2; KIAA0902; KSR2Connector enhancer of kinase suppressor of ras 2; Connector enhancer of KSR 2; CNK homolog protein 2; CNK2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
650-800aa
Target Protein Sequence
AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Surface plasmon resonance (SPR)

Review: Smurf2 immobilisation. a Stable baseline SPR responses obtained from immobilisation of Smurf2 on the GLC chip surface. Following ligand injection, the channel L4 stably captured Smurf2 protein giving a response of ~ 2000 response units (RU). b L6 was subsequently used as a reference channel.

By Anonymous

Target Background

Function
May function as an adapter protein or regulator of Ras signaling pathways.
Gene References into Functions
  1. High CNKSR2 expression is associated with breast cancer progression. PMID: 29534682
  2. CNKSR2 deletions: a novel cause of X-linked intellectual disability and seizures. PMID: 25754917
  3. This study describes the phenotype of CNKSR2 deficiency and its involvement in systems underlying common neurological PMID: 25223753
  4. CNK2 through interaction with Raf and Rlf may function as a regulator of Ras signaling. PMID: 14597674
  5. CNK and HYP form a discrete dimer by their SAM domains to mediate RAF kinase signaling. PMID: 18287031

Show More

Hide All

Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Protein Families
CNKSR family
Database Links

HGNC: 19701

OMIM: 300724

KEGG: hsa:22866

STRING: 9606.ENSP00000368824

UniGene: Hs.555917

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*