Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial

Code CSB-YP002414HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP002414HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
ATP7A
Uniprot No.
Alternative Names
Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK
Species
Homo sapiens (Human)
Expression Region
676-714
Target Protein Sequence
HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ATP-driven copper (Cu(+)) ion pump that plays an important role in intracellular copper ion homeostasis. Within a catalytic cycle, acquires Cu(+) ion from donor protein on the cytoplasmic side of the membrane and delivers it to acceptor protein on the lumenal side. The transfer of Cu(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation that shifts the pump conformation from inward-facing to outward-facing state. Under physiological conditions, at low cytosolic copper concentration, it is localized at the trans-Golgi network (TGN) where it transfers Cu(+) ions to cuproenzymes of the secretory pathway. Upon elevated cytosolic copper concentrations, it relocalizes to the plasma membrane where it is responsible for the export of excess Cu(+) ions. May play a dual role in neuron function and survival by regulating cooper efflux and neuronal transmission at the synapse as well as by supplying Cu(+) ions to enzymes such as PAM, TYR and SOD3. In the melanosomes of pigmented cells, provides copper cofactor to TYR to form an active TYR holoenzyme for melanin biosynthesis.
Gene References into Functions
  1. we demonstrated that the restoration/preservation of autophagic-lysosomal degradation in senescent MEFs following rapamycin treatment correlated with attenuation of copper accumulation in these cells despite a further decrease in Atp7a levels. This study for the first time establishes a link between Atp7a and the autophagic-lysosomal pathway, and a requirement for both to effect efficient copper export PMID: 29579719
  2. the severity of MD correlate with cellular localization of ATP7A and support previous studies indicating that phosphorylation is crucial for the exit of ATP7A from TGN, while dephosphorylation is crucial for recycling back to TGN. PMID: 28389643
  3. We determined in silico that all the mutations leading to the classical Menkes disease leave no residual activity of ATP7A including the apparently less severe in-frame deletions. Whereas milder forms of the disease are characterized by mutations that allow a limited residual activity of ATP7A, including the nonsense mutation observed. PMID: 28451781
  4. Candidate RNAi screen revealed copper-transporting ATPase (ATP7A) as a target for inducing cisplatin sensitivity. PMID: 27806319
  5. Mnk inhibition enhances apoptotic activity of cytarabine in acute myeloid leukemia cells PMID: 27462781
  6. The authors conclude that the ATP7A interactome encompasses a novel Golgi-localized conserved oligomeric Golgi (COG) complex-dependent mechanism to specify neuronal development and survival. PMID: 28355134
  7. Mutation in ATP7A gene is associated with X-linked distal hereditary motor neuropathy. PMID: 27293072
  8. MNK orchestrates counterbalancing forces that regulate mTORC1 enzymatic activity. PMID: 28178522
  9. 11 single-nucleotide polymorphisms (SNPs) in CTR1, CTR2, ATP7A, and ATP7B were genotyped in these patients. PMID: 28737129
  10. The P-type copper ATPases ATP7A and ATP7B provide an important system for acquisition, active transport, distribution and elimination of copper. Relevance of copper metabolism to human diseases and therapy is already known. It is quite certain that further studies will reveal detailed and useful information on biochemical mechanisms and relevance to diseases PMID: 27896900
  11. the mechanism of copper-dependent regulation of ATP7B and ATP7A, the roles of individual MBDs, and the relationship between the regulatory and catalytic copper binding are still unknown. We describe the structure and dynamics of the MBDs, review the current knowledge about their functional roles and propose a mechanism of regulation of ATP7B by copper-dependent changes in the dynamics and conformation of the MBD chain. PMID: 28271598
  12. Deletion spanning exons 8 to 12 of the ATP7A gene is associated with a family affected with Menkes disease. PMID: 28397223
  13. ATP-dependent copper transfer in ATP7A/B is not affected by varying the pH, suggesting that net proton counter-transport may not occur in copper ATPases. Platinum anticancer drugs activate ATP7A/B and are subjected to ATP-dependent vectorial displacement with a mechanism analogous to that of copper PMID: 28164426
  14. studies show that merestinib effectively blocks eIF4E phosphorylation in AML cells and suppresses primitive leukemic progenitors from AML patients in vitro and in an AML xenograft model in vivo. PMID: 27307295
  15. It has been demonstrated in ovarian cancer cells that cisplatin resistance and uptake correlates with reduced CTR1 and LRRC8A protein expression/activity and a concomitant upregulation in cisplatin exporting transporters (ATP7A, ATP7B), which implies that the resistant cells have a reduced ability to accumulate cisplatin and activate proapoptotic transporters for osmolytes. PMID: 27112899
  16. Thus, ATP7A activity protects mitochondria from excessive copper entry, which is deleterious to redox buffers. Mitochondrial redox misbalance could significantly contribute to pathologies associated with ATP7A inactivation in tissues with paradoxical accumulation of copper PMID: 27226607
  17. CTR1, ATP7A, and lysyl oxidase were upregulated in the lung tissues and pulmonary arteries of mice with hypoxia-induced pulmonary hypertension and pulmonary arterial smooth muscle cells. PMID: 24614111
  18. A total of 11 different ATP7A mutations were identified in the 11 Korean families tested: 3 frameshift, 2 nonsense, 3 large deletions, 2 splice-site, and 1 missense mutation. PMID: 24919650
  19. Data suggest that even small amounts of functional ATP7A in subjects with genetic diseases associated with mutant ATP7A result in milder phenotypes; this includes Menkes disease, occipital horn syndrome, and X-linked distal motor neuropathy. [REVIEW] PMID: 25172213
  20. we demonstrate here that (1) AP complexes 1 and 2 of the CCV traffic machinery physically interact with ATP7A. PMID: 25574028
  21. Twenty-five novel mutations including duplications, missense, and splice site variants enable us to confirm the pathogenic role of ATP7A mutations in Menkes disease and occipital horn syndrome. PMID: 21208200
  22. This study demonstrated that G727R missense mutation may be relatively common in Korea. PMID: 24882692
  23. Depletion of CCC complex components leads to lack of copper-dependent movement of the copper transporter ATP7A from endosomes, resulting in intracellular copper accumulation and modest alterations in copper homeostasis in humans with CCDC22 mutations. PMID: 25355947
  24. This is the first time the activation of pseudo-exons is demonstrated in the ATP7A gene, and it demonstrates the usefulness of RNA analysis, in terms of revealing disease-causing mutations in noncoding regions. PMID: 24002164
  25. Normal male karyotypes without c.3914A>G mutation on ATP7A gene was showed. Postnatal genetic analysis and normal development confirmed the prenatal diagnosis. PMID: 24927440
  26. Two mutations in the copper transporter ATP7A (ATP7A-T994I and ATP7A P1386S-) lead to isolated distal motor neuropathy PMID: 24754450
  27. this article reviews the history and evolution of our understanding of disorders caused by impaired ATP7A function, and outline future challenges. [review] PMID: 24735419
  28. This is the first report of a synonymous ATP7A substitution being responsible forMenkes disease . PMID: 24100245
  29. Duodenal CTR1 mRNA and protein expression was decreased in Wilson's disease patients, while ATP7A mRNA and protein production was increased. This can be a defense mechanism against systemic copper overload resulting from functional impairment of ATP7B. PMID: 23963605
  30. enhanced expression of Anx A4 confers platinum resistance by promoting efflux of platinum drugs via ATP7A. PMID: 24150977
  31. Decreased gene expression of ATP7A is associated with drug resistance in cervical cancer. PMID: 24403508
  32. Trafficking of the Menkes copper transporter ATP7A is regulated by clathrin-, AP-2-, AP-1-, and Rab22-dependent steps. PMID: 23596324
  33. Cisplatin binds to the copper-binding sites in the N-terminal domain of ATP7B; this binding may be an essential step of cisplatin detoxification involving copper ATPases. PMID: 23751120
  34. COX19 is necessary for the transduction of a SCO1-dependent mitochondrial redox signal that regulates ATP7A-mediated cellular copper efflux. PMID: 23345593
  35. ATP7A mutations leading to Menkes disease and occipital horn syndrome in human and animal models [Review] PMID: 23281160
  36. Tree males in a family with Menkes disease showed a missense mutation in an exon 8 splicing enhancer and equally reduced amounts of ATP7A transcript. PMID: 17496194
  37. review of ATP7A function to maintain intracellular copper levels and incorporate copper into copper-dependent enzymes PMID: 17989919
  38. Sec61beta-KD cells also exhibited altered ATP7A cellular distribution. PMID: 22710939
  39. findings illuminate the mechanisms underlying ATP7A-related distal motor neuropathy and establish a link between p97/VCP and genetically distinct forms of motor neuron degeneration PMID: 22210628
  40. ATP7A overexpression played an important role in platinum-resistance of non-small cell lung cancer. PMID: 22304828
  41. Partial ATP7A gene duplication was identified in 20 unrelated Menkes patients including one patient with Occipital Horn Syndrome (OHS) are estimated from our material to be the disease causing mutation in 4% of the Menkes disease patients. PMID: 22074552
  42. Clusterin and COMMD1 independently regulate degradation of the mammalian copper ATPases ATP7A and ATP7B. PMID: 22130675
  43. Binding of canine copper toxicosis protein COMMD1 partially restored the expression, subcellular localization, and copper-exporting activities of the ATP7A mutants. PMID: 21667063
  44. The lumenal loop Met672-Pro707 of copper-transporting ATPase ATP7A binds metals and facilitates copper release from the intramembrane sites. PMID: 21646353
  45. 33 novel splice site mutations in ATP7a gene detected in patients with Menkes disease, are described. PMID: 21494555
  46. Clusterin (apolipoprotein J), a molecular chaperone that facilitates degradation of the copper-ATPases ATP7A and ATP7B. PMID: 21242307
  47. MNK and WND were differentially localised within the placenta. PMID: 21115196
  48. The results of this study indicate that the A629P mutation of ATP7A does not have appreciable affects on the stability of copper-bound states but rather destabilizes the characteristic end-to-end beta-sheet. PMID: 20714486
  49. Disturbances of ATP7A and ATP7B function caused by mutations lead to severe metabolic diseases Menkes and Wilson diseases, respectively. PMID: 21117320
  50. Conclude that novel Atp7a protein variants may exist in human intestinal epithelial cells, with different intracellular locations and potentially distinct physiological functions. PMID: 19679821

Show More

Hide All

Involvement in disease
Menkes disease (MNKD); Occipital horn syndrome (OHS); Distal spinal muscular atrophy, X-linked, 3 (DSMAX3)
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Melanosome membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, postsynaptic density.; [Isoform 3]: Cytoplasm, cytosol.; [Isoform 5]: Endoplasmic reticulum.
Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Tissue Specificity
Widely expressed including in heart, brain, lung, muscle, kidney, pancreas, and to a lesser extent placenta. Expressed in fibroblasts, aortic smooth muscle cells, aortic endothelial cells and umbilical vein endothelial cells (at protein level).; [Isoform
Database Links

HGNC: 869

OMIM: 300011

KEGG: hsa:538

STRING: 9606.ENSP00000345728

UniGene: Hs.496414

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×