Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
11 beta HSD 1; 11 beta HSD1 ; 11 beta hydroxysteroid dehydrogenase 1; 11 DH ; 11-beta hydroxysteroid dehydrogenase; type 1; 11-beta-HSD1; 11-beta-hydroxysteroid dehydrogenase 1; 11-DH; 11DH ; Corticosteroid 11 beta dehydrogenase isozyme 1; Corticosteroid 11-beta-dehydrogenase isozyme 1; CORTRD2; DHI1_HUMAN; HDL; HSD 11; HSD11; HSD11B; HSD11B1; HSD11L; Hydroxysteroid (11 beta) dehydrogenase ; Hydroxysteroid (11 beta) dehydrogenase 1; MGC13539; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1
Species
Homo sapiens (Human)
Expression Region
25-292aa
Target Protein Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Human HSD11B1 protein started with the HSD11B1 gene synthesis. And then using recombinant DNA technology, the HSD11B1 gene was inserted into an expression vector so that we could get the recombinant express plasmid of HSD11B1. Transform the plasmid into the cells of E.coli, culture the cells and we could get the desired Recombinant Human HSD11B1 protein. But the work was not completed, protein purification and a strict QC system were performed in the last step. The purity is 90%+ determined by SDS-PAGE.
HSD11B1 is a gene providing an instruction of making a protein named Corticosteroid 11-beta-dehydrogenase isozyme 1 (HSD11B1) in human. The protein encoded by this gene is also known as 11-beta-hydroxysteroid dehydrogenase 1 (11-DH or 11-beta-HSD1) and short chain dehydrogenase/reductase family 26C member 1. The encoded protein is involved in lung development and steroid catabolic process with 11-beta-hydroxysteroid dehydrogenase (NADP+) and protein homodimerization activity. Moreover, it can bind to NADP and steroid.