Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1)

Code CSB-CF010763HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P28845
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence AFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Source in vitro E.coli expression system
Gene Names HSD11B1
Protein Names Recommended name: Corticosteroid 11-beta-dehydrogenase isozyme 1 EC= 1.1.1.146Alternative name(s): 11-beta-hydroxysteroid dehydrogenase 1 Short name= 11-DH Short name= 11-beta-HSD1
Expression Region 2-292
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol (By similarity).
Involvement in disease Cortisone reductase deficiency 2 (CORTRD2)
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Widely expressed. Highest expression in liver.
Database Links

HGNC: 5208

OMIM: 600713

KEGG: hsa:3290

STRING: 9606.ENSP00000261465

UniGene: Hs.195040

Related Products

HSD11B1 Antibodies

HSD11B1 Antibodies for Homo sapiens (Human)

HSD11B1 Antibodies for Human

HSD11B1 Proteins

HSD11B1 Proteins for Homo sapiens (Human)

HSD11B1 ELISA Kit

HSD11B1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.